BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021784 (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 25 0.68 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 25 0.68 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 24 1.6 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.1 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 4.8 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.3 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.3 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.3 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.3 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.3 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.3 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.3 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.3 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 25.0 bits (52), Expect = 0.68 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 149 FLRRAEHCMGKVAEAPESPVSKCVSSMSPIVV 54 +LRR C + EAP PV + + S++P+V+ Sbjct: 47 YLRRQLKCA--LGEAPCDPVGRRLKSLAPLVL 76 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 25.0 bits (52), Expect = 0.68 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 149 FLRRAEHCMGKVAEAPESPVSKCVSSMSPIVV 54 +LRR C + EAP PV + + S++P+V+ Sbjct: 47 YLRRQLKCA--LGEAPCDPVGRRLKSLAPLVL 76 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +1 Query: 487 PAVRSAS--CRQSKHSSRQINQLSIYRVNK 570 P+V SAS C++ K ++ ++ +IY+ NK Sbjct: 571 PSVMSASSTCKKDKKNAGSGSRFTIYKANK 600 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 11 PVGHISFLTVVKFKTQQWVTSKTHTSRPETPGPQ 112 P+ H S+ ++ T H PETPGPQ Sbjct: 447 PLAHSSYPAAIQIGH----TPHHHPHPPETPGPQ 476 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 215 FPVLDVDISTILHGR 171 FPVL V I+ +LHG+ Sbjct: 8 FPVLFVIINVLLHGQ 22 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 412 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 466 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 368 N L + +R N PSG +RS+ +P+S R Sbjct: 412 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,082 Number of Sequences: 438 Number of extensions: 5326 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -