BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021783 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 46 3e-05 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 46 4e-05 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 45 5e-05 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 45 5e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 45 7e-05 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 45 7e-05 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 45 7e-05 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 44 9e-05 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 44 9e-05 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 44 9e-05 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 44 1e-04 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 44 1e-04 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 44 1e-04 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 44 2e-04 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 44 2e-04 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 43 2e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 43 2e-04 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 43 2e-04 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 43 3e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 42 4e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 42 4e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 42 4e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 42 4e-04 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 42 5e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 42 5e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 42 5e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 42 5e-04 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 42 5e-04 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_12870| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 42 5e-04 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 42 6e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 42 6e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 42 6e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 42 6e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 42 6e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 42 6e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 42 6e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 42 6e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 42 6e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 42 6e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 42 6e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 42 6e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 42 6e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 42 6e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 42 6e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 42 6e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 42 6e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 42 6e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 42 6e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 42 6e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 42 6e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 42 6e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 42 6e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 42 6e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 42 6e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 42 6e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 42 6e-04 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 42 6e-04 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 42 6e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 42 6e-04 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.0 bits (109), Expect = 7e-06 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = -3 Query: 128 SVNIMTSTGQRFCYLKPVSVIVPRA----NSCSPGDPLVLERPPP 6 S NI ST C L + +IVP A NSCSPGDPLVLERPPP Sbjct: 10 SANIFLSTRTVHCSL--ILLIVPNATAQSNSCSPGDPLVLERPPP 52 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 48.0 bits (109), Expect = 7e-06 Identities = 24/50 (48%), Positives = 32/50 (64%) Frame = -3 Query: 155 QKLRGTERHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 Q L RH+ ++ ++ R CY +V ++NSCSPGDPLVLERPPP Sbjct: 159 QTLSCRPRHTDLVIQTSSYRPCYTD----LVIQSNSCSPGDPLVLERPPP 204 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 VS +V ++NSCSPGDPLVLERPPP Sbjct: 65 VSCVVQKSNSCSPGDPLVLERPPP 88 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 47.6 bits (108), Expect = 9e-06 Identities = 24/55 (43%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -3 Query: 167 RKTPQKLRGTERHSVN-IMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 R P L T S+ + S + F ++ + V+ +NSCSPGDPLVLERPPP Sbjct: 3 RLRPYHLESTGSRSITEVKLSRARHFLFV--IEVLTGLSNSCSPGDPLVLERPPP 55 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 +PR+NSCSPGDPLVLERPPP Sbjct: 1 MPRSNSCSPGDPLVLERPPP 20 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 46.8 bits (106), Expect = 2e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 80 PVSVIVPRANSCSPGDPLVLERPPP 6 P ++ P +NSCSPGDPLVLERPPP Sbjct: 14 PHELLAPTSNSCSPGDPLVLERPPP 38 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 VS I P +NSCSPGDPLVLERPPP Sbjct: 14 VSYIGPPSNSCSPGDPLVLERPPP 37 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/38 (63%), Positives = 28/38 (73%), Gaps = 5/38 (13%) Frame = -3 Query: 104 GQRFCYLKPVSVIVP-----RANSCSPGDPLVLERPPP 6 GQR Y + S++VP R+NSCSPGDPLVLERPPP Sbjct: 17 GQR--YFEHFSLVVPKQESIRSNSCSPGDPLVLERPPP 52 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 PR+NSCSPGDPLVLERPPP Sbjct: 21 PRSNSCSPGDPLVLERPPP 39 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 PR+NSCSPGDPLVLERPPP Sbjct: 68 PRSNSCSPGDPLVLERPPP 86 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 PR+NSCSPGDPLVLERPPP Sbjct: 16 PRSNSCSPGDPLVLERPPP 34 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 80 PVSVIVPRANSCSPGDPLVLERPPP 6 P + V R+NSCSPGDPLVLERPPP Sbjct: 868 PETSTVKRSNSCSPGDPLVLERPPP 892 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V V P +NSCSPGDPLVLERPPP Sbjct: 10 VGVRTPTSNSCSPGDPLVLERPPP 33 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V + V R+NSCSPGDPLVLERPPP Sbjct: 19 VIIAVRRSNSCSPGDPLVLERPPP 42 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = -3 Query: 89 YLKPVSVIVP-RANSCSPGDPLVLERPPP 6 +L+P +VI+ +NSCSPGDPLVLERPPP Sbjct: 15 FLRPCAVIMRITSNSCSPGDPLVLERPPP 43 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 80 PVSVIVPRANSCSPGDPLVLERPPP 6 PV + R+NSCSPGDPLVLERPPP Sbjct: 374 PVPRVDRRSNSCSPGDPLVLERPPP 398 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 VP +NSCSPGDPLVLERPPP Sbjct: 8 VPASNSCSPGDPLVLERPPP 27 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = -3 Query: 119 IMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 I + G FC V+ + P +NSCSPGDPLVLERPPP Sbjct: 9 ISANIGLPFC----VNGLSPGSNSCSPGDPLVLERPPP 42 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 VP +NSCSPGDPLVLERPPP Sbjct: 15 VPPSNSCSPGDPLVLERPPP 34 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 L+ + + P +NSCSPGDPLVLERPPP Sbjct: 55 LETILEVQPLSNSCSPGDPLVLERPPP 81 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 2/27 (7%) Frame = -3 Query: 80 PVSVIVPRA--NSCSPGDPLVLERPPP 6 P+ ++VP + NSCSPGDPLVLERPPP Sbjct: 50 PLLIVVPSSISNSCSPGDPLVLERPPP 76 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/23 (73%), Positives = 21/23 (91%) Frame = -3 Query: 74 SVIVPRANSCSPGDPLVLERPPP 6 ++ +P +NSCSPGDPLVLERPPP Sbjct: 12 NIDIPLSNSCSPGDPLVLERPPP 34 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 89 YLKPVSVIVPRANSCSPGDPLVLERPPP 6 YL P+ I+ +NSCSPGDPLVLERPPP Sbjct: 48 YLSPLEPIL--SNSCSPGDPLVLERPPP 73 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/26 (76%), Positives = 23/26 (88%), Gaps = 1/26 (3%) Frame = -3 Query: 80 PVSVIVPR-ANSCSPGDPLVLERPPP 6 PV ++PR +NSCSPGDPLVLERPPP Sbjct: 51 PVVGMLPRRSNSCSPGDPLVLERPPP 76 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V+VI +NSCSPGDPLVLERPPP Sbjct: 4 VNVISKTSNSCSPGDPLVLERPPP 27 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 +P +NSCSPGDPLVLERPPP Sbjct: 181 IPPSNSCSPGDPLVLERPPP 200 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -3 Query: 200 ENSRVTIDCLRRKTPQKLRGTERHSVNIMTSTGQRFCYLKPVSVIVPR-ANSCSPGDPLV 24 ENS + R + +KL T++ ++S ++ ++ + + + +NSCSPGDPLV Sbjct: 193 ENSLLKEHLERERFRRKLLETQQELAVAVSSERKKDVMIEQLDKLKKKTSNSCSPGDPLV 252 Query: 23 LERPPP 6 LERPPP Sbjct: 253 LERPPP 258 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -3 Query: 98 RFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 R+C P + +NSCSPGDPLVLERPPP Sbjct: 43 RYCMRSPDAHCRVPSNSCSPGDPLVLERPPP 73 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/23 (86%), Positives = 21/23 (91%), Gaps = 1/23 (4%) Frame = -3 Query: 71 VIVPRA-NSCSPGDPLVLERPPP 6 V +PRA NSCSPGDPLVLERPPP Sbjct: 5 VTMPRASNSCSPGDPLVLERPPP 27 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 L+ ++ + R+NSCSPGDPLVLERPPP Sbjct: 55 LRSRAIRLSRSNSCSPGDPLVLERPPP 81 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 1/25 (4%) Frame = -3 Query: 77 VSVIVP-RANSCSPGDPLVLERPPP 6 +S +P R+NSCSPGDPLVLERPPP Sbjct: 9 ISANIPKRSNSCSPGDPLVLERPPP 33 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.8 bits (101), Expect = 7e-05 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -3 Query: 131 HSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 +S + GQR + + I P +NSCSPGDPLVLERPPP Sbjct: 37 YSARARSPRGQR--QSENLRTIPPVSNSCSPGDPLVLERPPP 76 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 ++ R+NSCSPGDPLVLERPPP Sbjct: 20 IVEKRSNSCSPGDPLVLERPPP 41 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P++NSCSPGDPLVLERPPP Sbjct: 30 PQSNSCSPGDPLVLERPPP 48 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = -3 Query: 89 YLKPVSVIVPR-ANSCSPGDPLVLERPPP 6 Y +P S PR +NSCSPGDPLVLERPPP Sbjct: 7 YFEPDSNQRPRESNSCSPGDPLVLERPPP 35 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V+V V +NSCSPGDPLVLERPPP Sbjct: 187 VAVAVAVSNSCSPGDPLVLERPPP 210 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 + V R+NSCSPGDPLVLERPPP Sbjct: 1 MFVVRSNSCSPGDPLVLERPPP 22 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 74 SVIVPRANSCSPGDPLVLERPPP 6 ++IV +NSCSPGDPLVLERPPP Sbjct: 12 NIIVYTSNSCSPGDPLVLERPPP 34 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 1/22 (4%) Frame = -3 Query: 68 IVPR-ANSCSPGDPLVLERPPP 6 +VPR +NSCSPGDPLVLERPPP Sbjct: 22 LVPRPSNSCSPGDPLVLERPPP 43 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V P +NSCSPGDPLVLERPPP Sbjct: 135 VGHFAPSSNSCSPGDPLVLERPPP 158 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 44.4 bits (100), Expect = 9e-05 Identities = 24/56 (42%), Positives = 30/56 (53%) Frame = -3 Query: 173 LRRKTPQKLRGTERHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 L + P +LR E+ N G + L + +NSCSPGDPLVLERPPP Sbjct: 17 LYKNLPYELRICEKCEKN---KVGDEYHTLMECDYVNDISNSCSPGDPLVLERPPP 69 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -3 Query: 131 HSVNIMTSTGQRFCYLKPVSVI--VPRANSCSPGDPLVLERPPP 6 HS+ +T ++ +K + + + +NSCSPGDPLVLERPPP Sbjct: 76 HSIGAYRTTRRQTSKVKKKNAVTRIRTSNSCSPGDPLVLERPPP 119 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 ++ R+NSCSPGDPLVLERPPP Sbjct: 554 ILSDRSNSCSPGDPLVLERPPP 575 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V VI P +NSCSPGDPLVLERPPP Sbjct: 17 VQVIYP-SNSCSPGDPLVLERPPP 39 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 + P +NSCSPGDPLVLERPPP Sbjct: 43 IFKPTSNSCSPGDPLVLERPPP 64 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 92 CYLKPVSVIVPRANSCSPGDPLVLERPPP 6 C K +++ +NSCSPGDPLVLERPPP Sbjct: 4 CQFK-ADLVIKTSNSCSPGDPLVLERPPP 31 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 VSV + +NSCSPGDPLVLERPPP Sbjct: 12 VSVWLALSNSCSPGDPLVLERPPP 35 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 + P +NSCSPGDPLVLERPPP Sbjct: 27 VYPVSNSCSPGDPLVLERPPP 47 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/48 (47%), Positives = 28/48 (58%) Frame = -3 Query: 149 LRGTERHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 L G E H+ + S G P ++ +NSCSPGDPLVLERPPP Sbjct: 2 LGGAEGHTAILARSLGLPAVLGAPE--LLTASNSCSPGDPLVLERPPP 47 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 V + R+NSCSPGDPLVLERPPP Sbjct: 8 VKLERSNSCSPGDPLVLERPPP 29 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S +V +NSCSPGDPLVLERPPP Sbjct: 41 LSRVVVTSNSCSPGDPLVLERPPP 64 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -3 Query: 128 SVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 S NI+T + FC ++ P +NSCSPGDPLVLERPPP Sbjct: 10 SANILTYS---FCIVE-----FPGSNSCSPGDPLVLERPPP 42 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/48 (50%), Positives = 30/48 (62%) Frame = -3 Query: 149 LRGTERHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 + G ++HS N+ + C K S V +NSCSPGDPLVLERPPP Sbjct: 55 ISGDQKHSSNV----AKVHCR-KQRSREVATSNSCSPGDPLVLERPPP 97 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ ++NSCSPGDPLVLERPPP Sbjct: 21 IIRQSNSCSPGDPLVLERPPP 41 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = -3 Query: 92 CYLKPVSVIVPRANSCSPGDPLVLERPPP 6 C ++ + + +NSCSPGDPLVLERPPP Sbjct: 8 CIVQELGEYLTASNSCSPGDPLVLERPPP 36 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 +K + R+NSCSPGDPLVLERPPP Sbjct: 17 IKTANSKATRSNSCSPGDPLVLERPPP 43 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 +P +NSCSPGDPLVLERPPP Sbjct: 137 LPGSNSCSPGDPLVLERPPP 156 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 2/27 (7%) Frame = -3 Query: 80 PVSVIVP--RANSCSPGDPLVLERPPP 6 P S +V R+NSCSPGDPLVLERPPP Sbjct: 36 PCSYLVDPARSNSCSPGDPLVLERPPP 62 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 L V+ ++ +NSCSPGDPLVLERPPP Sbjct: 17 LMVVTEVIITSNSCSPGDPLVLERPPP 43 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -3 Query: 98 RFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 R+ L P + +V +NSCSPGDPLVLERPPP Sbjct: 16 RYAILSPRARLV--SNSCSPGDPLVLERPPP 44 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 5 PTSNSCSPGDPLVLERPPP 23 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -3 Query: 89 YLKPVSVIVPRANSCSPGDPLVLERPPP 6 Y +++ +NSCSPGDPLVLERPPP Sbjct: 5 YTAGTNLVTASSNSCSPGDPLVLERPPP 32 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = -3 Query: 128 SVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 S + + G + Y P ++NSCSPGDPLVLERPPP Sbjct: 5 SSKLTLTKGNKSWYRAPPRGRRAKSNSCSPGDPLVLERPPP 45 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 18 PASNSCSPGDPLVLERPPP 36 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 3 RSNSCSPGDPLVLERPPP 20 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 21 RSNSCSPGDPLVLERPPP 38 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 24 RSNSCSPGDPLVLERPPP 41 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 10 RSNSCSPGDPLVLERPPP 27 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 10 RSNSCSPGDPLVLERPPP 27 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 16 RSNSCSPGDPLVLERPPP 33 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 4 RSNSCSPGDPLVLERPPP 21 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 13 RSNSCSPGDPLVLERPPP 30 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 39 RSNSCSPGDPLVLERPPP 56 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 3 RSNSCSPGDPLVLERPPP 20 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 4 RSNSCSPGDPLVLERPPP 21 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 29 RSNSCSPGDPLVLERPPP 46 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 43.6 bits (98), Expect = 2e-04 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 4/70 (5%) Frame = -3 Query: 203 NENSRVTIDC--LRRKTPQKLRGTERHSVNIM-TSTGQRFCYLKPVSVIVPRA-NSCSPG 36 NE S + C L RK P KL R +VN M T G +++ + A NSCSPG Sbjct: 33 NELSDMVPSCTGLARK-PDKLT-VLRMAVNYMKTLRGDYMIFIRRGAKRQQMASNSCSPG 90 Query: 35 DPLVLERPPP 6 DPLVLERPPP Sbjct: 91 DPLVLERPPP 100 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 3 RSNSCSPGDPLVLERPPP 20 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 66 RSNSCSPGDPLVLERPPP 83 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 63 RSNSCSPGDPLVLERPPP 80 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 16 RSNSCSPGDPLVLERPPP 33 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 15 RSNSCSPGDPLVLERPPP 32 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 8 RSNSCSPGDPLVLERPPP 25 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 L+ V + +NSCSPGDPLVLERPPP Sbjct: 3 LRIVGLFYSASNSCSPGDPLVLERPPP 29 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 5 RSNSCSPGDPLVLERPPP 22 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 26 RSNSCSPGDPLVLERPPP 43 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 110 RSNSCSPGDPLVLERPPP 127 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 31 RSNSCSPGDPLVLERPPP 48 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 3 RSNSCSPGDPLVLERPPP 20 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 3 RSNSCSPGDPLVLERPPP 20 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 6 RSNSCSPGDPLVLERPPP 23 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 8 RSNSCSPGDPLVLERPPP 25 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/25 (68%), Positives = 23/25 (92%), Gaps = 2/25 (8%) Frame = -3 Query: 74 SVIVPR--ANSCSPGDPLVLERPPP 6 ++++P+ +NSCSPGDPLVLERPPP Sbjct: 22 NILIPKIASNSCSPGDPLVLERPPP 46 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 39 PPSNSCSPGDPLVLERPPP 57 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 92 RSNSCSPGDPLVLERPPP 109 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 20 RSNSCSPGDPLVLERPPP 37 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/43 (48%), Positives = 28/43 (65%) Frame = -3 Query: 134 RHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 +H + + S F L+ + V+ +NSCSPGDPLVLERPPP Sbjct: 2 KHFTDTLISANIVFNILEVIHVL---SNSCSPGDPLVLERPPP 41 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 54 RSNSCSPGDPLVLERPPP 71 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 7 RSNSCSPGDPLVLERPPP 24 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANIVESNSCSPGDPLVLERPPP 32 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 10 RSNSCSPGDPLVLERPPP 27 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ +NSCSPGDPLVLERPPP Sbjct: 59 IITTSNSCSPGDPLVLERPPP 79 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S+ +NSCSPGDPLVLERPPP Sbjct: 29 ISLATKTSNSCSPGDPLVLERPPP 52 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 29 RSNSCSPGDPLVLERPPP 46 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 44 RSNSCSPGDPLVLERPPP 61 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 3 RSNSCSPGDPLVLERPPP 20 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -3 Query: 98 RFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 R+C+ K ++ +NSCSPGDPLVLERPPP Sbjct: 39 RYCWPKDIA-----SNSCSPGDPLVLERPPP 64 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 11 RSNSCSPGDPLVLERPPP 28 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 17 RSNSCSPGDPLVLERPPP 34 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 322 RSNSCSPGDPLVLERPPP 339 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 16 RSNSCSPGDPLVLERPPP 33 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 25 RSNSCSPGDPLVLERPPP 42 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 60 RSNSCSPGDPLVLERPPP 77 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 5 RSNSCSPGDPLVLERPPP 22 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -3 Query: 134 RHSVNIMTSTGQRFCYLKPVSVIVPR-ANSCSPGDPLVLERPPP 6 +H + + S L+ + V V + +NSCSPGDPLVLERPPP Sbjct: 2 KHFTDTLISANISIKILQELKVEVQKGSNSCSPGDPLVLERPPP 45 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 7 RSNSCSPGDPLVLERPPP 24 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 14 RSNSCSPGDPLVLERPPP 31 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 7 RSNSCSPGDPLVLERPPP 24 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 VS+ + +NSCSPGDPLVLERPPP Sbjct: 4 VSLSLRASNSCSPGDPLVLERPPP 27 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 8 RSNSCSPGDPLVLERPPP 25 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ +NSCSPGDPLVLERPPP Sbjct: 85 IIQTSNSCSPGDPLVLERPPP 105 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 8 VAAALELVDPPGCRN 52 VAAALELVDPPGCRN Sbjct: 9 VAAALELVDPPGCRN 23 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 12 RSNSCSPGDPLVLERPPP 29 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Frame = -3 Query: 146 RGTERHSVNIMTSTGQRFCYLKPVSVIVPR----ANSCSPGDPLVLERPPP 6 R RH+ ++ + K ++ +P +NSCSPGDPLVLERPPP Sbjct: 5 RNDRRHATQLLETPSIAIATHKLNTLFIPSTQMASNSCSPGDPLVLERPPP 55 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 71 PPSNSCSPGDPLVLERPPP 89 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 55 RSNSCSPGDPLVLERPPP 72 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 96 PPSNSCSPGDPLVLERPPP 114 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 14 RSNSCSPGDPLVLERPPP 31 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 54 RSNSCSPGDPLVLERPPP 71 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 3 RSNSCSPGDPLVLERPPP 20 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 31 RSNSCSPGDPLVLERPPP 48 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 214 RSNSCSPGDPLVLERPPP 231 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 11 PGSNSCSPGDPLVLERPPP 29 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 8 RSNSCSPGDPLVLERPPP 25 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 19 RSNSCSPGDPLVLERPPP 36 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 1 RSNSCSPGDPLVLERPPP 18 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 5 RSNSCSPGDPLVLERPPP 22 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 21/22 (95%), Gaps = 1/22 (4%) Frame = -3 Query: 68 IVPR-ANSCSPGDPLVLERPPP 6 I+P+ +NSCSPGDPLVLERPPP Sbjct: 10 IIPKPSNSCSPGDPLVLERPPP 31 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 R+NSCSPGDPLVLERPPP Sbjct: 21 RSNSCSPGDPLVLERPPP 38 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/25 (76%), Positives = 21/25 (84%), Gaps = 1/25 (4%) Frame = -3 Query: 77 VSVIVPR-ANSCSPGDPLVLERPPP 6 VS + P +NSCSPGDPLVLERPPP Sbjct: 155 VSALPPHLSNSCSPGDPLVLERPPP 179 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 74 SVIVPRANSCSPGDPLVLERPPP 6 S++ +NSCSPGDPLVLERPPP Sbjct: 11 SIVQQISNSCSPGDPLVLERPPP 33 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 +I +NSCSPGDPLVLERPPP Sbjct: 31 IIASLSNSCSPGDPLVLERPPP 52 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 80 PVSVIVPRANSCSPGDPLVLERPPP 6 PV + +NSCSPGDPLVLERPPP Sbjct: 44 PVQDEIKISNSCSPGDPLVLERPPP 68 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANINSSNSCSPGDPLVLERPPP 32 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 2 PVSNSCSPGDPLVLERPPP 20 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 62 PRANSCSPGDPLVLERPPP 6 P +NSCSPGDPLVLERPPP Sbjct: 63 PVSNSCSPGDPLVLERPPP 81 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -3 Query: 98 RFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 + C + +S I +NSCSPGDPLVLERPPP Sbjct: 26 KICTSRQLS-ITSTSNSCSPGDPLVLERPPP 55 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 +IV +NSCSPGDPLVLERPPP Sbjct: 4 MIVVVSNSCSPGDPLVLERPPP 25 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 74 SVIVPRANSCSPGDPLVLERPPP 6 +V + +NSCSPGDPLVLERPPP Sbjct: 540 AVQIQESNSCSPGDPLVLERPPP 562 >SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 ++ +NSCSPGDPLVLERPPP Sbjct: 2 VIDTSNSCSPGDPLVLERPPP 22 >SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANITGSNSCSPGDPLVLERPPP 32 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 L+ + + +NSCSPGDPLVLERPPP Sbjct: 141 LRDLEEVANSSNSCSPGDPLVLERPPP 167 >SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 89 YLKPVSVIVPRANSCSPGDPLVLERPPP 6 Y K + ++NSCSPGDPLVLERPPP Sbjct: 39 YGKAIEAEEGQSNSCSPGDPLVLERPPP 66 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = -3 Query: 134 RHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 +H + + S R L S + +NSCSPGDPLVLERPPP Sbjct: 2 KHFTDTLISANIRISVLALKSRPMLVSNSCSPGDPLVLERPPP 44 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 ++P S +NSCSPGDPLVLERPPP Sbjct: 86 IEPPSATGISSNSCSPGDPLVLERPPP 112 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/56 (46%), Positives = 31/56 (55%) Frame = -3 Query: 173 LRRKTPQKLRGTERHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 +R +PQ ++G E N R Y V V +NSCSPGDPLVLERPPP Sbjct: 15 IRLNSPQ-IKGLELKIKNGSKLLTTRIHYENKRRVYVT-SNSCSPGDPLVLERPPP 68 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 43.2 bits (97), Expect = 2e-04 Identities = 29/91 (31%), Positives = 43/91 (47%) Frame = -3 Query: 278 HFTKNMNHKNLVTCRNLFIKHARAHNENSRVTIDCLRRKTPQKLRGTERHSVNIMTSTGQ 99 HFT + N ++ N + + +H N R + L RG E ++ + Sbjct: 3 HFTDTLISAN-ISAFNAIVDLSASHARN-RPSHPPLEAWVTLAARGAE-----VVVDPRE 55 Query: 98 RFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 ++ +V +NSCSPGDPLVLERPPP Sbjct: 56 VVHHIISAETMVIESNSCSPGDPLVLERPPP 86 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 + ++NSCSPGDPLVLERPPP Sbjct: 20 VASQSNSCSPGDPLVLERPPP 40 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 IV +NSCSPGDPLVLERPPP Sbjct: 13 IVHISNSCSPGDPLVLERPPP 33 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 VI +NSCSPGDPLVLERPPP Sbjct: 7 VISELSNSCSPGDPLVLERPPP 28 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V ++ +NSCSPGDPLVLERPPP Sbjct: 793 VMLVAISSNSCSPGDPLVLERPPP 816 >SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 ++ +NSCSPGDPLVLERPPP Sbjct: 6 VIQGSNSCSPGDPLVLERPPP 26 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S +P +NSCSPGDPLVLERPPP Sbjct: 9 ISANIP-SNSCSPGDPLVLERPPP 31 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -3 Query: 80 PVSVIVPRANSCSPGDPLVLERPPP 6 P + + +NSCSPGDPLVLERPPP Sbjct: 7 PSASFLSSSNSCSPGDPLVLERPPP 31 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANISVSNSCSPGDPLVLERPPP 32 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANIISSNSCSPGDPLVLERPPP 32 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/75 (38%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Frame = -3 Query: 209 AHNEN-SRVTIDCLRRKTPQKLRGTERHSVNIMTSTGQRFCYLKPVSVI------VPRAN 51 A N+N +R L + P+ L T SV ++ T +P+ V +N Sbjct: 35 AENKNGTRTPRSALNKHLPKYLH-TFIRSVQAVSGTAVSGVDFEPLQTTINIPPSVSTSN 93 Query: 50 SCSPGDPLVLERPPP 6 SCSPGDPLVLERPPP Sbjct: 94 SCSPGDPLVLERPPP 108 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 10/71 (14%) Frame = -3 Query: 188 VTIDCLRRKTPQKLRGTERHSVNIMTSTGQRFC------YLKPVSV----IVPRANSCSP 39 + ID LR T GTE + ++ T R C ++ ++V ++ +NSCSP Sbjct: 37 ICIDILRNVTKTVKSGTEVFKLTVVV-TLSRDCGRSANKLMRKLAVDASNLLLTSNSCSP 95 Query: 38 GDPLVLERPPP 6 GDPLVLERPPP Sbjct: 96 GDPLVLERPPP 106 >SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ +NSCSPGDPLVLERPPP Sbjct: 10 ILDTSNSCSPGDPLVLERPPP 30 >SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 89 YLKPVSVIVPRANSCSPGDPLVLERPPP 6 +L ++ + +NSCSPGDPLVLERPPP Sbjct: 10 FLSHITDLYWESNSCSPGDPLVLERPPP 37 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S +P +NSCSPGDPLVLERPPP Sbjct: 9 ISANIP-SNSCSPGDPLVLERPPP 31 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 11 KSNSCSPGDPLVLERPPP 28 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I +NSCSPGDPLVLERPPP Sbjct: 6 ITTTSNSCSPGDPLVLERPPP 26 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = -3 Query: 113 TSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 T+ F PV+ + +NSCSPGDPLVLERPPP Sbjct: 245 TAESVEFLRENPVTEYI--SNSCSPGDPLVLERPPP 278 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = -3 Query: 182 IDCLRRKTPQKLRGTERHS-VNIMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 +D L + P L G V + +TG + P+ +NSCSPGDPLVLERPPP Sbjct: 854 LDPLTKAIPGLLEGLYLMGRVKYLAATGPSLSHPFPLVT----SNSCSPGDPLVLERPPP 909 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 11 VTSSNSCSPGDPLVLERPPP 30 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 L PVS + +NSCSPGDPLVLERPPP Sbjct: 55 LAPVSRTL-LSNSCSPGDPLVLERPPP 80 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 + +I +NSCSPGDPLVLERPPP Sbjct: 74 IIIIWAGSNSCSPGDPLVLERPPP 97 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/38 (52%), Positives = 26/38 (68%) Frame = -3 Query: 119 IMTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 + + + R Y K VS+ +NSCSPG+PLVLERPPP Sbjct: 1 VKSKSASRVHYRKIVSI----SNSCSPGEPLVLERPPP 34 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 V+ +NSCSPGDPLVLERPPP Sbjct: 7 VLTVGSNSCSPGDPLVLERPPP 28 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 22 KSNSCSPGDPLVLERPPP 39 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 74 SVIVPRANSCSPGDPLVLERPPP 6 S+ V +NSCSPGDPLVLERPPP Sbjct: 6 SLCVFLSNSCSPGDPLVLERPPP 28 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANIVISNSCSPGDPLVLERPPP 32 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -3 Query: 89 YLKPVSVIVPRANSCSPGDPLVLERPPP 6 YL P V +NSCSPGDPLVLERPPP Sbjct: 8 YLNPE---VGTSNSCSPGDPLVLERPPP 32 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 12 VSSSNSCSPGDPLVLERPPP 31 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 188 KSNSCSPGDPLVLERPPP 205 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 21 KSNSCSPGDPLVLERPPP 38 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 20 KSNSCSPGDPLVLERPPP 37 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -3 Query: 80 PVSVIVPRANSCSPGDPLVLERPPP 6 P + +NSCSPGDPLVLERPPP Sbjct: 37 PPTTYAEPSNSCSPGDPLVLERPPP 61 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 80 PVSVIVPRANSCSPGDPLVLERPPP 6 P +I +NSCSPGDPLVLERPPP Sbjct: 5 PFYLIPMVSNSCSPGDPLVLERPPP 29 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 4 VQASNSCSPGDPLVLERPPP 23 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 14 KSNSCSPGDPLVLERPPP 31 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = -3 Query: 101 QRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 Q C K +NSCSPGDPLVLERPPP Sbjct: 32 QSGCARKRARAEAALSNSCSPGDPLVLERPPP 63 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 IV +NSCSPGDPLVLERPPP Sbjct: 3 IVIISNSCSPGDPLVLERPPP 23 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 L V VP +NSCSPGDPLVLERPPP Sbjct: 38 LSAVFETVP-SNSCSPGDPLVLERPPP 63 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 92 CYLKPVSVIVPRANSCSPGDPLVLERPPP 6 C + +S+ +NSCSPGDPLVLERPPP Sbjct: 2 CVVITLSLGFVPSNSCSPGDPLVLERPPP 30 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 5 KSNSCSPGDPLVLERPPP 22 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 3 KSNSCSPGDPLVLERPPP 20 >SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 V V +NSCSPGDPLVLERPPP Sbjct: 5 VRVKPSNSCSPGDPLVLERPPP 26 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ +NSCSPGDPLVLERPPP Sbjct: 13 ILHASNSCSPGDPLVLERPPP 33 >SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 3 KSNSCSPGDPLVLERPPP 20 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 68 VTATESNSCSPGDPLVLERPPP 89 >SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 9 VDASNSCSPGDPLVLERPPP 28 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/26 (69%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = -3 Query: 80 PVSVIVPR-ANSCSPGDPLVLERPPP 6 P+ +P +NSCSPGDPLVLERPPP Sbjct: 29 PMQHAIPALSNSCSPGDPLVLERPPP 54 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 22 VAASNSCSPGDPLVLERPPP 41 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 11 KSNSCSPGDPLVLERPPP 28 >SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 6 VQTSNSCSPGDPLVLERPPP 25 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 4 KSNSCSPGDPLVLERPPP 21 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 89 YLKPVSVIVPRANSCSPGDPLVLERPPP 6 YL + V +NSCSPGDPLVLERPPP Sbjct: 35 YLFVLLVANKPSNSCSPGDPLVLERPPP 62 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 18 KSNSCSPGDPLVLERPPP 35 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 +VP +NSCSPGDPLVLERPPP Sbjct: 27 LVP-SNSCSPGDPLVLERPPP 46 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ +NSCSPGDPLVLERPPP Sbjct: 13 ILAGSNSCSPGDPLVLERPPP 33 >SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 Query: 95 FCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 +C P V +NSCSPGDPLVLERPPP Sbjct: 14 WCSYSPPPVFT--SNSCSPGDPLVLERPPP 41 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 +++ +NSCSPGDPLVLERPPP Sbjct: 42 LVIGISNSCSPGDPLVLERPPP 63 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 42.3 bits (95), Expect = 4e-04 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 3/97 (3%) Frame = -3 Query: 287 YKAHFTKNMNHKNLVTCRNLFIKHARAHNENSRVTIDCLRR---KTPQKLRGTERHSVNI 117 YK ++ ++N N I+ ++ ++ + L K L ER I Sbjct: 19 YKINYDSSLNRSNGFPVFATIIEANFITKQDDKMAVTSLTDEDIKAINALSKDERIGERI 78 Query: 116 MTSTGQRFCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 + S G + + + +NSCSPGDPLVLERPPP Sbjct: 79 IASIGPSIYGHEDIKRALA-SNSCSPGDPLVLERPPP 114 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 6 KSNSCSPGDPLVLERPPP 23 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 V+ +NSCSPGDPLVLERPPP Sbjct: 511 VVTFLSNSCSPGDPLVLERPPP 532 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 + +NSCSPGDPLVLERPPP Sbjct: 19 INESNSCSPGDPLVLERPPP 38 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 6 QSNSCSPGDPLVLERPPP 23 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 32 VHASNSCSPGDPLVLERPPP 51 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 2 QSNSCSPGDPLVLERPPP 19 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V V+ +NSCSPGDPLVLERPPP Sbjct: 1015 VFVVGLGSNSCSPGDPLVLERPPP 1038 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 62 QSNSCSPGDPLVLERPPP 79 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANIFLSNSCSPGDPLVLERPPP 32 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 ++ +NSCSPGDPLVLERPPP Sbjct: 11 VLNSSNSCSPGDPLVLERPPP 31 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 29 QSNSCSPGDPLVLERPPP 46 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 11 QSNSCSPGDPLVLERPPP 28 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ +NSCSPGDPLVLERPPP Sbjct: 76 ILLTSNSCSPGDPLVLERPPP 96 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 ++ +NSCSPGDPLVLERPPP Sbjct: 5 VIFTSNSCSPGDPLVLERPPP 25 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 + +NSCSPGDPLVLERPPP Sbjct: 8 IKTSNSCSPGDPLVLERPPP 27 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 ++ +NSCSPGDPLVLERPPP Sbjct: 1 MVTSPSNSCSPGDPLVLERPPP 22 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 +V +NSCSPGDPLVLERPPP Sbjct: 1 MVITSNSCSPGDPLVLERPPP 21 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 +S + +NSCSPGDPLVLERPPP Sbjct: 9 ISANIIISNSCSPGDPLVLERPPP 32 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 V + + +NSCSPGDPLVLERPPP Sbjct: 13 VPLTILGSNSCSPGDPLVLERPPP 36 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 86 LKPVSVIVPRANSCSPGDPLVLERPPP 6 LKP I +NSCSPGDPLVLERPPP Sbjct: 26 LKPTFSI---SNSCSPGDPLVLERPPP 49 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+P +NSCSPGDPLVLERPPP Sbjct: 64 ILP-SNSCSPGDPLVLERPPP 83 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 17 QSNSCSPGDPLVLERPPP 34 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 + +NSCSPGDPLVLERPPP Sbjct: 17 IRESNSCSPGDPLVLERPPP 36 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 13 QSNSCSPGDPLVLERPPP 30 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = -3 Query: 95 FCYLKPVSVIVPRANSCSPGDPLVLERPPP 6 F KP ++ +NSCSPGDPLVLERPPP Sbjct: 26 FIQAKPYNI---PSNSCSPGDPLVLERPPP 52 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 V+ +NSCSPGDPLVLERPPP Sbjct: 16 VLTVVSNSCSPGDPLVLERPPP 37 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/18 (88%), Positives = 18/18 (100%) Frame = -3 Query: 59 RANSCSPGDPLVLERPPP 6 ++NSCSPGDPLVLERPPP Sbjct: 14 QSNSCSPGDPLVLERPPP 31 >SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -3 Query: 77 VSVIVPRANSCSPGDPLVLERPPP 6 + + V +NSCSPGDPLVLERPPP Sbjct: 6 IVLTVGGSNSCSPGDPLVLERPPP 29 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 ++ +NSCSPGDPLVLERPPP Sbjct: 224 LLESSNSCSPGDPLVLERPPP 244 >SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 29 VTGSNSCSPGDPLVLERPPP 48 >SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 + +NSCSPGDPLVLERPPP Sbjct: 4 ISASNSCSPGDPLVLERPPP 23 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 V +NSCSPGDPLVLERPPP Sbjct: 23 VEGSNSCSPGDPLVLERPPP 42 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -3 Query: 65 VPRANSCSPGDPLVLERPPP 6 + +NSCSPGDPLVLERPPP Sbjct: 37 IKASNSCSPGDPLVLERPPP 56 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 89 YLKPVSVIVPRANSCSPGDPLVLERPPP 6 +LK VS + +NSCSPGDPLVLERPPP Sbjct: 10 WLKFVSKV---SNSCSPGDPLVLERPPP 34 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 71 VIVPRANSCSPGDPLVLERPPP 6 V+ +NSCSPGDPLVLERPPP Sbjct: 16 VLPAPSNSCSPGDPLVLERPPP 37 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 68 IVPRANSCSPGDPLVLERPPP 6 I+ +NSCSPGDPLVLERPPP Sbjct: 9 IMLASNSCSPGDPLVLERPPP 29 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,251,021 Number of Sequences: 59808 Number of extensions: 394661 Number of successful extensions: 2559 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2558 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -