BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021783 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 24 1.6 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 4.8 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 4.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 6.3 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +1 Query: 205 CARACFINKFRQVTKFLWFIFLVKCALYGLQFWDFFGKPRRTPVR 339 C F+ K R++ +L+ ++ C + + + F+ KP P R Sbjct: 233 CLEVVFVLK-RRLGYYLFHTYIPTCLIVIMSWVSFWIKPEAAPAR 276 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 676 LSSFFLFGR*FCGALIVYDRPCCVVS 599 L +++FG FC I +D C S Sbjct: 87 LLGYWVFGPRFCDTWIAFDVMCSTAS 112 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 149 LRGTERHSVNIMTSTGQRFCYLKPVSVIVPRANSCSPG 36 + T I+T G+ FC ++P+ + N C+ G Sbjct: 118 IESTSNKMTVILTPPGRFFCEVRPIKRVKDSTN-CNCG 154 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 63 ASCQFLQPGG 34 A C+FL PGG Sbjct: 66 AKCEFLNPGG 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,317 Number of Sequences: 438 Number of extensions: 3216 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -