BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021781 (654 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U71268-1|AAD00180.1| 575|Homo sapiens potential transcriptional... 30 8.3 U71267-1|AAD00179.1| 642|Homo sapiens potential transcriptional... 30 8.3 BC035590-1|AAH35590.1| 572|Homo sapiens CCR4-NOT transcription ... 30 8.3 AL389980-1|CAB97536.1| 572|Homo sapiens NOT4, potential transcr... 30 8.3 AF180475-1|AAF29829.1| 433|Homo sapiens Not4-Np protein. 30 8.3 >U71268-1|AAD00180.1| 575|Homo sapiens potential transcriptional repressor NOT4Hp protein. Length = 575 Score = 29.9 bits (64), Expect = 8.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 523 LNLDPLCAFPVRNRHQKCKKTWHTIQSKRNGL 428 L +D + FP +Q C+ WH I++ NGL Sbjct: 21 LEIDDINFFPCTCGYQICRFCWHRIRTDENGL 52 >U71267-1|AAD00179.1| 642|Homo sapiens potential transcriptional repressor NOT4Hp protein. Length = 642 Score = 29.9 bits (64), Expect = 8.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 523 LNLDPLCAFPVRNRHQKCKKTWHTIQSKRNGL 428 L +D + FP +Q C+ WH I++ NGL Sbjct: 21 LEIDDINFFPCTCGYQICRFCWHRIRTDENGL 52 >BC035590-1|AAH35590.1| 572|Homo sapiens CCR4-NOT transcription complex, subunit 4 protein. Length = 572 Score = 29.9 bits (64), Expect = 8.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 523 LNLDPLCAFPVRNRHQKCKKTWHTIQSKRNGL 428 L +D + FP +Q C+ WH I++ NGL Sbjct: 21 LEIDDINFFPCTCGYQICRFCWHRIRTDENGL 52 >AL389980-1|CAB97536.1| 572|Homo sapiens NOT4, potential transcriptional repressor, alternatively spliced product protein. Length = 572 Score = 29.9 bits (64), Expect = 8.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 523 LNLDPLCAFPVRNRHQKCKKTWHTIQSKRNGL 428 L +D + FP +Q C+ WH I++ NGL Sbjct: 21 LEIDDINFFPCTCGYQICRFCWHRIRTDENGL 52 >AF180475-1|AAF29829.1| 433|Homo sapiens Not4-Np protein. Length = 433 Score = 29.9 bits (64), Expect = 8.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 523 LNLDPLCAFPVRNRHQKCKKTWHTIQSKRNGL 428 L +D + FP +Q C+ WH I++ NGL Sbjct: 21 LEIDDINFFPCTCGYQICRFCWHRIRTDENGL 52 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,619,241 Number of Sequences: 237096 Number of extensions: 1525889 Number of successful extensions: 3091 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3091 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -