BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021781 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22040.1 68416.m02780 receptor-like protein kinase-related co... 29 2.0 At2g40560.1 68415.m05004 protein kinase family protein contains ... 28 4.7 >At3g22040.1 68416.m02780 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function that is usually associated with protein kinase domain Pfam:PF00069; similar to receptor-like protein kinase 5 (GI:13506747){Arabidopsis thaliana} Length = 257 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 459 HVFLHF*CRLRTGKAHNGSRFKYYFHLL 542 +V+LH CR+ GK H GSR++ F L Sbjct: 33 NVYLHHKCRVGQGKYHPGSRYEKDFDSL 60 >At2g40560.1 68415.m05004 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 303 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 268 EIINIGCFVTKFYLIIFNFHHFDDFYIRHL 357 +I ++GC V + + I +FD+FY+ HL Sbjct: 211 DIYSLGCVVNEMFGAIPIQEYFDEFYVWHL 240 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,502,841 Number of Sequences: 28952 Number of extensions: 236022 Number of successful extensions: 593 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -