BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021780 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13019| Best HMM Match : F5_F8_type_C (HMM E-Value=7.4e-23) 32 0.40 SB_54782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 >SB_13019| Best HMM Match : F5_F8_type_C (HMM E-Value=7.4e-23) Length = 498 Score = 32.3 bits (70), Expect = 0.40 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 379 VITIPNLKETFAVHIFSRSYSLLINVQSNFTTKIYVTSYKITTMK 513 V + ++ + F V++ R Y + Q F+T YVTSYK+ K Sbjct: 352 VSAVNDVNQFFQVNLQRRHYVTAVATQRRFSTSQYVTSYKVQHSK 396 >SB_54782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = -2 Query: 518 LCFIVVILYDVT*IFVVKLD*TLISKEYERE----NICTANVSFKFGIVITSVFMA 363 L F VV ++ + IF +LD L+ K ++ N CT + F+FG V+ S+ +A Sbjct: 295 LLFYVVPMFTLYDIFENQLDIPLLRKVGDQPLKCYNGCTPKLVFRFGFVVVSMVVA 350 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,064,229 Number of Sequences: 59808 Number of extensions: 332472 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -