BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021779 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 2.0 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.6 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 6.1 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 6.1 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 607 LTNILNFAYKIYSIVYLYCTNLKNGKSLTLLN 512 +TN+ N Y Y + CT+ +N + ++++N Sbjct: 353 VTNLTNLTYPSYYNQDVSCTHYQNPEYISVVN 384 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 237 FHLLTDDYYHLLPFC 193 +HL + YY++L FC Sbjct: 322 YHLEIEKYYNILYFC 336 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 186 YVDKKGVSDNNHQLISENYQ*RYMYSAVSNACM*P 290 Y K G +NNH NY ++ +NA M P Sbjct: 431 YSGKVGYYENNHYNGDPNYISPEVFPNTNNAIMTP 465 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.8 bits (44), Expect = 6.1 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 186 YVDKKGVSDNNHQLISENYQ*RYMYSAVSNACM*P 290 Y K G +NNH NY ++ +NA M P Sbjct: 379 YSGKVGYYENNHYNGDPNYISPEVFPNTNNAIMTP 413 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,219 Number of Sequences: 336 Number of extensions: 3162 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -