BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021779 (756 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0982 - 22025279-22027277,22030256-22030488,22031205-220313... 31 1.3 06_03_0805 + 24775346-24775543,24775643-24775858,24775930-247759... 30 1.7 >10_08_0982 - 22025279-22027277,22030256-22030488,22031205-22031344, 22032783-22032957 Length = 848 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -3 Query: 607 LTNILNFAYKIYSIVYLYCTNLKNGKSLTLLNFLHLSPKILRH 479 LT N K+YS+ L ++ GK+L L+ L P++LRH Sbjct: 643 LTEFANSLSKLYSLRRLIIGDVGYGKTLNFLDQLPSPPQLLRH 685 >06_03_0805 + 24775346-24775543,24775643-24775858,24775930-24775970, 24776510-24776551,24777019-24777055,24779796-24780092 Length = 276 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 607 VKDYEILIKSDVIIGGRPWSSARFGSTKTWKAACRSTRTSTKFC 738 V+ Y I V + GRP + G T T + CRS S +FC Sbjct: 90 VQTYVINSAKIVFLNGRPQARPGKGVTNTCEICCRSLPDSFRFC 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,040,361 Number of Sequences: 37544 Number of extensions: 253548 Number of successful extensions: 444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -