BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021776 (703 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0620 - 8151065-8151791,8152246-8152418 31 0.67 08_02_1139 - 24638824-24639325,24639528-24639713,24639801-246405... 29 3.6 09_04_0597 - 18859601-18859818,18860914-18861083,18861250-188613... 28 8.3 >04_01_0620 - 8151065-8151791,8152246-8152418 Length = 299 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = -3 Query: 578 RWDVFWLIESFHHDFDSHACDSRSSTMFCRWLKSCSHPAT 459 +WD +W+ F+H A + + CR C P T Sbjct: 3 KWDGYWMARWFYHTIPFEAGSDSAKALLCRRQGDCIEPET 42 >08_02_1139 - 24638824-24639325,24639528-24639713,24639801-24640543, 24640709-24640870,24641141-24641500 Length = 650 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 589 GGTCDGMSFGLLKAFIMTLIPMPAIADPPL 500 G G SFG+L I T P PAIA P + Sbjct: 578 GAAAAGFSFGMLPRSIATPAPSPAIAVPAM 607 >09_04_0597 - 18859601-18859818,18860914-18861083,18861250-18861303, 18862759-18863284,18864465-18864663,18866787-18866852, 18866999-18867300,18867394-18867634,18867716-18867973, 18868076-18868207 Length = 721 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 504 GGSAIAGMGIKVMMKAFNKPKDIPSQVPPLTPG 602 GG+A A G V +A K + + ++VPP+ PG Sbjct: 23 GGAAAAASGFPVSSRA-TKIRRLDAEVPPVVPG 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,022,189 Number of Sequences: 37544 Number of extensions: 347533 Number of successful extensions: 995 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -