BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021774 (725 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 25 0.83 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 24 1.1 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 7.7 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 7.7 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 7.7 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 24.6 bits (51), Expect = 0.83 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 Query: 9 LDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVY 143 +D K E H+E+ A + E+R+ + +G+ T L + VY Sbjct: 178 IDEKAEEHKEQFTALVREIRNAFRH--DGLLLTMSVLPNVNSSVY 220 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 Query: 248 DLANLFLMFAQTLDHLLEVLVTLVGSCG 165 ++ NL+L + L++ +TLV CG Sbjct: 263 EIDNLYLKHKLEISSLVQTAITLVAMCG 290 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 7.7 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 170 SCRQA*REPQEDDRASART*GTSSQGPRRNQEKFQQLESA 289 SC + P+ED+R A + G S N + F + ++A Sbjct: 32 SCLKTTPPPEEDNRGCAASVGEGSFYLPMNMQGFVKQQTA 71 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 21.4 bits (43), Expect = 7.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 356 VSLSAQLQ*ADVGRRPAAASPGWRSRAAGTS 264 VSLS RP AS G R+R A TS Sbjct: 64 VSLSENRSHEPEMERPKGASNGKRARTAYTS 94 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.4 bits (43), Expect = 7.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 356 VSLSAQLQ*ADVGRRPAAASPGWRSRAAGTS 264 VSLS RP AS G R+R A TS Sbjct: 84 VSLSENRSHEPEMERPKGASNGKRARTAYTS 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,429 Number of Sequences: 336 Number of extensions: 2349 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -