BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021774 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 26 0.31 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 24 1.7 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 26.2 bits (55), Expect = 0.31 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +3 Query: 528 PAEQERPHRDRGPALLRLERGPPTHASHAHVTTVRFDICHTRPPT 662 P PH G + GPP H H H T + + +PPT Sbjct: 328 PHRGSSPHHQHGNHTMGPTMGPP-HHHHHHQTQSLQHLHYRQPPT 371 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.8 bits (49), Expect = 1.7 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 9/52 (17%) Frame = +3 Query: 33 EEKREAYINELRSRLKDHLEGV---------EKTRLTLEQQTAEVYKAIEDK 161 E+K + + + S+L D LE V E +LTL Q+TA+ +K ++DK Sbjct: 354 EKKNLSKVIDQHSQLIDTLENVLAIVDRLMDETNQLTL-QETADAFKDLQDK 404 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,447 Number of Sequences: 438 Number of extensions: 3171 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -