BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021771X (610 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 22 5.4 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 7.1 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 16 CAVCPYNTITRVLRSRITKNHSLKYRVSELSNIKELIRVC*SVEI*KKK 162 C C Y+ + + + + K+HS Y+ +N + C S+++ +K Sbjct: 19 CEKCSYSCVNKSMLNSHLKSHSNVYQY-RCANCTYATKYCHSLKLHLRK 66 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -3 Query: 419 GTSLAPSAPALRTDGHRTRHIT 354 G S P R GHR RH T Sbjct: 178 GISNEVELPQFRVLGHRQRHST 199 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,679 Number of Sequences: 438 Number of extensions: 2217 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -