BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021767 (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) 32 0.35 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_37531| Best HMM Match : zf-B_box (HMM E-Value=2.4) 30 1.9 SB_6595| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_38664| Best HMM Match : HC2 (HMM E-Value=0.95) 28 7.5 SB_16901| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21755| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_7911| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = +2 Query: 557 MGSLNVNRNVSDAFYRYKMPRICANVQGKG 646 M +NVNR D FYRYKMP++ A V+GKG Sbjct: 1 MALVNVNRKNMDQFYRYKMPKLIAKVEGKG 30 >SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) Length = 971 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/55 (27%), Positives = 24/55 (43%) Frame = +3 Query: 45 VDRSTQFNNVFREVSFKLTVWCVAGRCGVRDSTRCSFSRSQDQQFIKSQSSRPSG 209 V+ T + + L +WC GR GVR R + +Q +S ++R G Sbjct: 309 VEAETMYRLRYANTGHSLLLWCFTGRSGVRCPVRPHYRHGCEQLLFRSCNTRTLG 363 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 31.1 bits (67), Expect = 0.81 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%) Frame = +1 Query: 169 INNSSSRRALVHLGVT--VLYDFSKIFRNIRLCAESSRCVATGGTAASRRGCMTLNTTRY 342 I++S+ R +V G + V +DFSK + + + S GG A+ +G T NT + Sbjct: 361 ISSSAYRVGVVIFGSSAKVAFDFSKFSSSAEIESGLSEIKLIGGATAAGQGLTTCNTALF 420 Query: 343 TVRRTS 360 + R+S Sbjct: 421 SKARSS 426 >SB_37531| Best HMM Match : zf-B_box (HMM E-Value=2.4) Length = 63 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 458 HSCSNQCKYQVKIVNYLITCK 520 H+C +CKYQ + N TCK Sbjct: 17 HTCETRCKYQAQYDNRYFTCK 37 >SB_6595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 458 HSCSNQCKYQVKIVNYLITCK 520 H+C +CKYQ + N TCK Sbjct: 346 HTCETRCKYQAQYDNRYFTCK 366 >SB_48437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4247 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -1 Query: 176 LLILASGE--AAASRIAHAAPTCHTPHRQLK*HFAENIIKLCTSIDYSNRLLMPQQL 12 LL+L SG A+ ++HA+ T T HR A C ++ SN+ L Q L Sbjct: 3435 LLVLGSGRLFGPAAAMSHASTTSSTQHRMAIESAAIRFFCKCITMHPSNQQLFAQLL 3491 >SB_38664| Best HMM Match : HC2 (HMM E-Value=0.95) Length = 210 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 126 GVRDSTRCSFSRSQDQQFIKSQSSRPSG 209 G R+S+R S SRS + +S SSR SG Sbjct: 29 GRRESSRSSSSRSSSRSVSRSSSSRGSG 56 >SB_16901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 909 Score = 27.5 bits (58), Expect = 9.9 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = -1 Query: 359 DVLRTVYLVVLSVMHPRRLAAVPPVATH----RLLSAHSLMFLNILLKSYKTVTPRWTRA 192 D +RT + +LSV H R A+P + H + S+ +L+ L L+S + + Sbjct: 633 DAIRTTHKPLLSVSHLIRACAMPYLGRHDNKNGISSSTALLLLKSSLESIQPDMAAYGSF 692 Query: 191 LRLDELLIL 165 L+LD + I+ Sbjct: 693 LQLDLIPII 701 >SB_21755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 374 LLQNFDVLRTVYLVVLSVMHPRRLAAVPPV-ATHRLLSAHSLMFLNIL 234 LL L T Y +L++ P L + V ATH LL H++ NIL Sbjct: 75 LLAKHSALLTTYPTLLTI-RPALLTTLTTVLATHTLLGKHAVAVSNIL 121 >SB_7911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 409 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = -1 Query: 356 VLRTVYLVVLSVMHPRRLAAVPPVATHRLLSAHSLMFLNILLKSYKTVTPRWTRALRLDE 177 V R V+ V + ++ R+ +V + LL +FL++L+K + P W RAL L+ Sbjct: 242 VERPVFPVAMRLL---RIVSVLIEQFYTLLVTECEIFLSLLVKFLDSGKPLWQRALALEV 298 Query: 176 L 174 L Sbjct: 299 L 299 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,576,534 Number of Sequences: 59808 Number of extensions: 458137 Number of successful extensions: 1826 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1826 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -