BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021767 (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 5.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.9 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 5.9 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 278 VLPQEERPPAVEG 316 V PQEERP + G Sbjct: 219 VSPQEERPKGING 231 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -1 Query: 296 VPPVATHRLLSAHSLMFLNILLKSYKTVTPRW 201 VPP++ H M L L SY P W Sbjct: 391 VPPISGSATPVFHQEMALYYLKPSYDAQEPAW 422 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 278 VLPQEERPPAVEG 316 V PQEERP + G Sbjct: 214 VSPQEERPKGING 226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,451 Number of Sequences: 438 Number of extensions: 3884 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -