BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021766 (731 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 3.4 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 5.9 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 395 YSQAFTREYGRDLIEDLKSELGGHFEDVIVAL 490 + Q F E R L+EDL++E + DV+V + Sbjct: 142 FIQIFNEETKR-LVEDLEAECHKPYIDVVVPI 172 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +3 Query: 366 YQVQHAAASHIHRPSHESMEEISL 437 + + H S+IH P H +E + Sbjct: 363 HNMGHVFISYIHDPDHRHLESFGV 386 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,847 Number of Sequences: 336 Number of extensions: 4160 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -