BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021758 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.2 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.5 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +1 Query: 178 VQEQTERSAPTERRGGHQGTHAA*SLVPNQSLEAHNFVTGM 300 +Q T T R GH H+A S+V + + N T + Sbjct: 923 IQVSTSAGLQTIRLSGHSVLHSAQSVVASSASNVTNVTTNL 963 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 136 TVAVQIPRESEQVFVQEQTERSAPTERRGGHQG 234 T+ VQ+P + ++V T S + GH G Sbjct: 1398 TLTVQVPPSAPVLYVTSSTSSSILLHWKSGHNG 1430 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 136 TVAVQIPRESEQVFVQEQTERSAPTERRGGHQG 234 T+ VQ+P + ++V T S + GH G Sbjct: 1394 TLTVQVPPSAPVLYVTSSTSSSILLHWKSGHNG 1426 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +1 Query: 256 VPNQSLEAHNFVTGMKLEAL*PSGHEDGATGHRLQGVQQLPF 381 V +S H+ + GM L + + + T H L V PF Sbjct: 243 VAGESFTVHDGIFGMALSPVTNNLYYSPLTSHSLYYVNMEPF 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,117 Number of Sequences: 438 Number of extensions: 3331 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -