BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021757X (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 27 0.12 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 4.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 4.7 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 26.6 bits (56), Expect = 0.12 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 343 NNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVK 441 +N +V VSG V PI+ FE A + V +K Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIK 212 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 4.7 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -2 Query: 250 PIWATHVLTSREFFFP 203 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 4.7 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -2 Query: 250 PIWATHVLTSREFFFP 203 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,149 Number of Sequences: 438 Number of extensions: 1859 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -