BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021756 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 26 1.1 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 25 3.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 5.9 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 7.7 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 311 DVWQQFLEGWIVVQVVFDGLRIIVFFPMST 222 D++ Q E W V +V D L++ +FF ++T Sbjct: 461 DLYIQTREDWKYVAMVIDRLQLYIFFIVTT 490 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 252 QAIKDHLDNNPALEKLLPHIKGNVGFV 332 QA+ HL NNP ++ L +K V V Sbjct: 109 QAVLSHLRNNPITDEHLAKVKRGVEIV 135 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 5.9 Identities = 14/65 (21%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Frame = +2 Query: 563 VGASEATLLNMLNISPFS-YGLVVKQVYDSGT--IFAPEILDIKPEDLRAKFQAGVANVA 733 VG +E+ +++N+ F+ Y + + +Y +G + + +KPED+ +A + Sbjct: 261 VGVTESA--DLINLEKFAQYAVAIAAMYKTGLGKLSEKATVKVKPEDVPLNLRAHDVSTH 318 Query: 734 ALSLA 748 +++L+ Sbjct: 319 SMTLS 323 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 7.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 532 VDDFNSTLEILVGIERAWKKEV 467 +DD +T+E + I R W + V Sbjct: 655 IDDLENTIETSINIIRQWMESV 676 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 840,381 Number of Sequences: 2352 Number of extensions: 17135 Number of successful extensions: 62 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -