BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021754 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_42265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -2 Query: 291 LHASSTTLRLAGPSANPSLASYRLHNLRNMTGGRRVMAAAGLTTRRFSSK 142 LH+S+ T GPSA+ S S + R GR + L+ + FS + Sbjct: 101 LHSSANTASTDGPSADTSSQSGAASHERQAAPGRMDVIRRSLSAKEFSDE 150 >SB_14689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1900 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -2 Query: 258 GPSANPSLASYRLHNLRNMTGGRRVMAAAGLTTRRFSS 145 G A+PS + RL +LR+ G +R + LTT++ +S Sbjct: 1341 GKKADPSEVATRLKSLRSDDGRKRFASEEWLTTQQITS 1378 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,061,257 Number of Sequences: 59808 Number of extensions: 401016 Number of successful extensions: 1036 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -