BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021749 (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 27 0.62 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 3.3 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 3.3 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 4.4 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 4.4 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 4.4 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 24 5.8 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 24 5.8 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 23 7.7 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 27.1 bits (57), Expect = 0.62 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 42 HSILYNFSCSSTNFNTLNQYGRSKSASRRHWSTKRHPSLESSHH 173 HS+ Y ++++F + Y ++ STKR P E S++ Sbjct: 2079 HSLRYPMDSAASSFTLIYDYNKNGEVKSIKESTKRVPMFEFSYN 2122 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 541 SSAHLPGRVPVAEHPPGRGARRDRAVPGRTHH 636 S + + +P +HPPG G + +P + H Sbjct: 222 SGSRMEYLLPHQQHPPGAGVQGAGPIPSQQKH 253 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.6 bits (51), Expect = 3.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 495 NTKQRVAAQIKRLAPILTNWARRS*K*VNRIDSARCPPGR 376 N + A I+++ P N RRS + R S R PP R Sbjct: 238 NIYKNAHASIRKIPPSRRNPRRRSPRSGGRWPSCRSPPAR 277 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 399 YLFYSLIFMNVVPNLLILVPIFLFALLHAAS 491 Y ++L+FM ++P LLIL+ +L + +S Sbjct: 349 YTTFTLVFMFIIP-LLILIGTYLSTFMTISS 378 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 24.2 bits (50), Expect = 4.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 623 VVLIMALFGHCGLMSPFVYYYFVT 694 V +MAL + L PF Y+ +VT Sbjct: 149 VAFVMALERYIALAKPFFYHKYVT 172 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 399 YLFYSLIFMNVVPNLLILVPIFLFALLHAAS 491 Y ++L+FM ++P LLIL+ +L + +S Sbjct: 350 YTTFTLVFMFIIP-LLILIGTYLSTFMTISS 379 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 5.8 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = +3 Query: 321 HQRIPAREISLSRDFMAR--FFLEDSAHY---LFYSLIFMNVVPNLLILVPIFLFAL 476 + R+ +R SL R++ R +L ++ L+YSL+ NV + L L+P + L Sbjct: 82 YARVVSRVKSLQREYADRNPIYLNAGDNFQGTLWYSLLRWNVTAHFLNLLPADVMTL 138 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.8 bits (49), Expect = 5.8 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Frame = +3 Query: 321 HQRIPAREISLSRDFMAR--FFLEDSAHY---LFYSLIFMNVVPNLLILVPIFLFAL 476 + R+ +R SL R++ R +L ++ L+YSL+ NV + L L+P + L Sbjct: 82 YARVVSRVKSLQREYADRNPIYLNAGDNFQGTLWYSLLRWNVTAHFLNLLPADVMTL 138 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.4 bits (48), Expect = 7.7 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = +3 Query: 135 STKRHPSLESSHHCQ*NRRSSLGGPRNHRAVYHWIRVPVVNNPVSAFYKALLANAATS 308 S R P + H Q RRSS R R+V +++ + F + + N + S Sbjct: 60 SKNRMPPVPPPKHSQRRRRSSSPRTRQFRSVCYYVSESEMEKIEMLFARCSVGNNSPS 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,620 Number of Sequences: 2352 Number of extensions: 16113 Number of successful extensions: 48 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -