BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021748 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 47 7e-07 AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 pr... 23 7.5 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 46.8 bits (106), Expect = 7e-07 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = +2 Query: 671 AVVTVPAYFNDAQRQATKDAGTI 739 AV+TVPAYFND+QRQATKDAG I Sbjct: 2 AVITVPAYFNDSQRQATKDAGAI 24 >AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 protein. Length = 99 Score = 23.4 bits (48), Expect = 7.5 Identities = 12/49 (24%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = -2 Query: 301 PTHE*VVPKSIPMTVPCPYLSPSCRRHKRPR---PPKLARTNSTAS*PC 164 P H+ V+P +P+ +P + + P P + A+ N PC Sbjct: 32 PLHDYVIPNGMPIMIPIYAIHRDPKYFPNPTVFDPERFAKENLDQIQPC 80 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,144 Number of Sequences: 2352 Number of extensions: 14593 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -