BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021748 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 7.0 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.2 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 5.3 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 435 PENTVFDAKRLIGREWSDQTVQHDVSSSPS-RSLKRTANLMFKYK 566 P N AK +IG+++S V H SS + +K+ + KY+ Sbjct: 468 PLNVQRAAKCIIGKDYSLPMVNHSKSSRINIERMKQVYQQLNKYR 512 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -2 Query: 700 IEISRHCNNSMSNLFSKVS 644 IE++ CN S ++L ++V+ Sbjct: 527 IEVTEDCNKSFNDLLTQVA 545 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = -3 Query: 105 QPR*DHFKMLLSNTCVFKQYTDTFRSIVQEKPVGG 1 QP + + + + V + TFR++ + +P+GG Sbjct: 536 QPGKNTIEQKSTKSSVTIPFERTFRNLDENRPIGG 570 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,654 Number of Sequences: 438 Number of extensions: 4176 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -