BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021747X (481 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 5.4 AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N p... 22 9.5 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 5.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 336 WKFETSKYYVTIIDAPG 386 W +E K+ T+I+ PG Sbjct: 487 WNYEDYKFRTTVINMPG 503 >AY341146-1|AAR13710.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 22.2 bits (45), Expect = 9.5 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -3 Query: 365 NIVLASFELPESNIDCDTTLTLSL*FVQYPSIFEGSFPISWASFSN 228 +I+ S ++ S D L+L + + P IF+ +P+ + SN Sbjct: 8 DILFESLQVAASE-DAVLPLSLDVGTIMRPWIFQSGYPVVTVTLSN 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,838 Number of Sequences: 2352 Number of extensions: 9318 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -