BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021743 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373... 31 1.3 07_03_0846 - 21983581-21986055 29 3.0 02_04_0276 + 21491150-21492761,21492891-21492947,21493817-214938... 28 7.0 03_05_0951 + 29093962-29094373,29095291-29095388,29095689-290960... 28 9.2 >06_03_1055 - 27234824-27234838,27236087-27236125,27236322-27237388, 27237422-27237630,27237650-27238053 Length = 577 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -2 Query: 229 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 95 A+ A +GK + E E S+QCD T + +S RE ++R+P+ + Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473 >07_03_0846 - 21983581-21986055 Length = 824 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +3 Query: 87 DLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASA 236 DL+D G +R +C+T S PD S VS+ LPD+A+ A A Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQSAVA 373 >02_04_0276 + 21491150-21492761,21492891-21492947,21493817-21493870, 21493994-21494022 Length = 583 Score = 28.3 bits (60), Expect = 7.0 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = -2 Query: 316 RTFGSCTRPSGRWCEATIRGICLNASKAEAS--LAESGKDMLTVEPRESG--GSKQCDFT 149 R GS RP C A I+ + + AEA LA G D++ +G G+ Q D Sbjct: 86 RLVGSARRPDAGTCAALIKKLSASGRTAEARRVLAACGPDVMAYNAMVAGYCGAGQLDAA 145 Query: 148 SRV 140 R+ Sbjct: 146 RRL 148 >03_05_0951 + 29093962-29094373,29095291-29095388,29095689-29096087, 29096999-29097724,29097802-29097968,29098046-29098311, 29098396-29098581,29099072-29099346,29099435-29099683 Length = 925 Score = 27.9 bits (59), Expect = 9.2 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = -2 Query: 238 KAEASLAESGKDMLTVEP-RESGGSKQCDFTSRVSHSKRETR-RRSPFGSRRSMLSVFFL 65 K+ AS A G D P R GG K+ S + SKR + R + F +L L Sbjct: 4 KSSASAAHQGGDAPAEAPRRRGGGGKRKSGGSSFTPSKRHAKERNAAFHVPPHLLHSGPL 63 Query: 64 TRASR 50 TRA+R Sbjct: 64 TRAAR 68 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,638,313 Number of Sequences: 37544 Number of extensions: 468577 Number of successful extensions: 1252 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1252 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -