BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021743 (755 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.3 At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 28 5.8 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 7.7 At1g14740.1 68414.m01762 expressed protein 28 7.7 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 692 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 579 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +1 Query: 463 RNDRKSRHRRIKKQRPMNAWLPQASYPC 546 R +RKS ++ +KK+ + +W ++S+PC Sbjct: 135 REERKSIYKDVKKEEEIESW-SESSHPC 161 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -2 Query: 286 GRWCEATIRGICLNASKAEASLAESGKDMLTVEPRESGGSKQCD 155 G W + + +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 27.9 bits (59), Expect = 7.7 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = -2 Query: 346 YCSVREEPQFRTFGSCTRP-SGRWCEATIRGICLNASKAEASLAESGKDMLTVEPRESGG 170 + +VR F S + P SG E T+ +C N+ K SL + GK+++T S Sbjct: 46 FLNVRSNNLDGGFSSKSSPRSGN--ELTLSYLCENSGKLAESLGQKGKEVVTFSENSSYD 103 Query: 169 SK--QCDFTSRVSHSKRETRRRS 107 K + DF + + ++R++ Sbjct: 104 DKWVERDFFNLREMNPNSSKRKA 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,829,333 Number of Sequences: 28952 Number of extensions: 352691 Number of successful extensions: 946 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -