BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021742 (709 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ400853-1|CAC14138.1| 1201|Homo sapiens MUC4 protein splice var... 33 1.3 DQ022562-1|AAY87461.1| 404|Homo sapiens pim-1 kinase 44 kDa iso... 31 3.1 >AJ400853-1|CAC14138.1| 1201|Homo sapiens MUC4 protein splice variant sv16 protein. Length = 1201 Score = 32.7 bits (71), Expect = 1.3 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 481 CASPRLASTDRTG-QAQWRWLFHDGKSDLPASRG 579 C S R T AQWRWLF +D+PAS G Sbjct: 1164 CFSTRAVGCSGTWPSAQWRWLFRKQPTDVPASVG 1197 >DQ022562-1|AAY87461.1| 404|Homo sapiens pim-1 kinase 44 kDa isoform protein. Length = 404 Score = 31.5 bits (68), Expect = 3.1 Identities = 27/72 (37%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Frame = +2 Query: 284 FSA-PVPS-YPSRRYDRKTDHIYQYFDDVLWHRSSDHRW*NRLL*EFHT-SPAHSLPHCS 454 FSA P P+ PSRR R+ + D R+S N H+ SP HSL H Sbjct: 13 FSALPDPAGAPSRRQSRQRPQLSS--DSPSAFRASRSHSRNATRSHSHSHSPRHSLRHSP 70 Query: 455 GTGRCPSPVAHR 490 G+G C S HR Sbjct: 71 GSGSCGSSSGHR 82 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,678,217 Number of Sequences: 237096 Number of extensions: 2844773 Number of successful extensions: 6973 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6973 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8231208258 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -