BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021740 (730 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 24 5.5 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 7.3 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 455 DCTKSTLILHSFSFPVLRGDHDAH*FTFKC 366 +C K T IL +F VL GD KC Sbjct: 62 ECVKETGILPKNAFRVLSGDFSVDTMKAKC 91 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 360 WPTFESKLVRIVITAEYWKTKRVQY*STFSAI 455 W T ESK V IV+ +R+++ T + Sbjct: 46 WVTDESKTVAIVVNGNRLPIQRIRHRQTLGVV 77 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,450 Number of Sequences: 2352 Number of extensions: 12799 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -