BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021739 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 2.5 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 3.4 Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 7.8 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 2.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -1 Query: 453 SCRRGAGILFPTTACHGPHSLRGRDSWTPEGSH 355 SC R AG F T+ S R S + GSH Sbjct: 1330 SCERIAGETFECTSTSSKFSTSSRGSGSDSGSH 1362 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.6 bits (51), Expect = 3.4 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 497 VCQHNRIYGFYDEC-KRRYNIKLWKTFTDCFNC 592 +CQHN D+C K Y L T DC C Sbjct: 744 ICQHNTAGDTCDQCAKGYYGNALGGTPYDCKRC 776 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 7.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 384 RDSWTPEGSHHTQTT 340 ++ W PE +HH Q T Sbjct: 37 KEKWVPEITHHCQKT 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,730 Number of Sequences: 2352 Number of extensions: 18883 Number of successful extensions: 40 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -