BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021736 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) 32 0.36 SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.62 SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.83 SB_11863| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.1 SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) 31 1.1 SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.1 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.1 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.9 SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.9 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_42412| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-33) 29 3.3 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.3 SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) 29 4.4 SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.8 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_21372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_6334| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-26) 28 5.8 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.8 SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.7 SB_25397| Best HMM Match : zf-C2H2 (HMM E-Value=0.38) 28 7.7 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 28 7.7 SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.7 SB_41428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) 28 7.7 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 4/68 (5%) Frame = +3 Query: 306 PHASSYQCPICESTFVNTSDLEVHVNVDHKDILSPQKDDQIDNASCDDI----VMMEESP 473 P A Y+ +C+ + N HKD + P K D DN SCD V + S Sbjct: 1232 PGACDYRGDMCDKDTDCQMPQKCCFNGCHKDCVKPGKADPCDNVSCDYYAQCQVEDDGST 1291 Query: 474 VSNCPVCC 497 CP+ C Sbjct: 1292 SCKCPIFC 1299 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 318 SYQCPICESTFVNTSDLEVHVNVDHKDI 401 +YQC C+ F T+D+ HV V H DI Sbjct: 449 AYQCDHCDMRFSRTNDVTRHVQVAHTDI 476 Score = 30.7 bits (66), Expect = 1.1 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDH 392 Y+C +C+S F++++DL H+ H Sbjct: 508 YECDLCDSVFISSADLSNHMRSAH 531 >SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) Length = 427 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 306 PHASSYQCPICESTFVNTSDLEVHVNVDHK 395 P +SS QC ICE F S+L H+ V K Sbjct: 174 PRSSSIQCEICERKFKYLSNLRTHLKVHKK 203 >SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1239 Score = 31.5 bits (68), Expect = 0.62 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 285 TMAMSPGPHASSYQCPICESTFVNTSDLEVHVNVDHKD 398 T M H S++CP C TF S L VHV H D Sbjct: 1101 TFLMHMRLHEGSFKCPKCPMTFPRRSRLAVHVRT-HSD 1137 >SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 615 Score = 31.1 bits (67), Expect = 0.83 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +3 Query: 171 ALRFDITVFECKREC*LRQSDPGLVQPDITLENPTLALTMAMSPGPHASSYQCPICESTF 350 A+ T ++C+ C G ++ I T+ L + S G ++C IC F Sbjct: 418 AIHVSGTPYKCEY-CGKEFRTKGCIKAHIKYHIGTIVLMSSDSGGGGDKRHKCSICGHAF 476 Query: 351 VNTSDLEVHV 380 V ++DL+ HV Sbjct: 477 VKSADLKRHV 486 >SB_11863| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 921 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKDILSPQKDDQIDN 434 YQCP C+S F L H+ HK Q +DQ ++ Sbjct: 681 YQCPKCDSRFTFHGTLRKHLTRIHKRPEGEQMEDQYND 718 >SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) Length = 1771 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 330 PICESTFVNTSDLEVHVNVDHKDILSPQKDDQID 431 P+ + +F+ DLE+ VN ++ PQ+D +ID Sbjct: 1017 PVDQESFMEPKDLELPVNEPDVEVYEPQQDIEID 1050 >SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 30.7 bits (66), Expect = 1.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDH 392 Y+C IC F+++S+L H+ + H Sbjct: 279 YKCSICNWKFISSSNLRTHIRIHH 302 >SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 907 Score = 30.7 bits (66), Expect = 1.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKD 398 +QC +CE F++ +DL H H D Sbjct: 264 FQCDLCEKAFIDRADLRRHCQRTHSD 289 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 279 ALTMAMSPGPHASSYQCPICESTFVNTSDLEVHVNVDHKD 398 AL + M + CP+C FVN S L VH V ++ Sbjct: 540 ALRVHMMRHDGVKPFSCPLCTQRFVNQSALNVHQKVHSEE 579 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKDILSPQK 416 ++CP+C F T +L HV H+ P++ Sbjct: 484 FECPVCHKAFSQTGNLSKHVRYVHEKQQRPKE 515 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKDILSPQKDDQI 428 ++CP C F + S+L HV HK P KD ++ Sbjct: 145 FKCPECGKNFSSGSNLRKHVR-KHKPGYKPYKDKRV 179 >SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1741 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/61 (22%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKDILSPQKDDQI--DNASCDDIVMMEESPVSNCPVC 494 + C C+++F + H+N H+ I++ KD + D M + P +C Sbjct: 923 FMCKTCQNSFEIKGEFVAHINKQHEGIVATLKDQPLFFDGHGGWVAFEMRDFPNQTLCIC 982 Query: 495 C 497 C Sbjct: 983 C 983 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 29.5 bits (63), Expect = 2.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKD 398 Y+C ICE +F + L +H+ + + D Sbjct: 545 YRCEICEKSFRDKDSLNIHMRIHNND 570 >SB_42412| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-33) Length = 644 Score = 29.1 bits (62), Expect = 3.3 Identities = 26/83 (31%), Positives = 35/83 (42%), Gaps = 7/83 (8%) Frame = +3 Query: 267 NPTLALTMAMSPGPHAS--SYQCPICESTFVNTSDLEVHV-----NVDHKDILSPQKDDQ 425 N T+A +S AS SY C +CE F + LE H+ N HK P+ Q Sbjct: 306 NKTVAEARTISTVKDASEKSYDCRVCERVFKSHELLEKHIKNHAENRPHKCPQCPKGFKQ 365 Query: 426 IDNASCDDIVMMEESPVSNCPVC 494 + + +E P NC VC Sbjct: 366 PSHLAQHLRTHTDERPF-NCKVC 387 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/86 (22%), Positives = 41/86 (47%), Gaps = 1/86 (1%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKDILSPQKDDQIDNASCDDIVMMEESPVSNCPV-CC 497 Y+C C F + D+ H+ +H D++ ++Q++ C ++ + P+++ P+ Sbjct: 1008 YKCQDCGYYFQSEDDVLNHIKRNHPDLIPLSVEEQVNLQEC---LVTKTVPMTHSPLEQV 1064 Query: 498 QPLPCHNMN*YNILRSILRGVKMVHQ 575 P H + I R+ +G +HQ Sbjct: 1065 APQQIHVPDQLPIHRNPAQGQVPLHQ 1090 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDH---KDILSPQKDDQIDNAS 440 +QC C + F + S L +H+ H K +SP K+ I A+ Sbjct: 2153 HQCEYCATRFASKSSLSLHIRKFHQITKHYISPLKEPVIGRAN 2195 >SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 28.7 bits (61), Expect = 4.4 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNV 386 Y+C +C F+ +DL++H+ + Sbjct: 106 YKCDVCGKCFIQNADLKIHLRI 127 Score = 28.7 bits (61), Expect = 4.4 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNV 386 Y+C +C F+ +DL++H+ + Sbjct: 162 YKCDVCGKCFIQNADLKIHLRI 183 >SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) Length = 595 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 312 ASSYQCPICESTFVNTSDLEVHVNV 386 A Y+CP C F + DL+ H+N+ Sbjct: 488 ARPYRCPYCLKLFRYSGDLKQHINI 512 >SB_52826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2126 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNV--DHKDILSPQKDDQIDNA--SCDDIVMMEESP 473 ++CP+C F+ T L H+ D + LS + D I N D + E SP Sbjct: 2004 HKCPLCGKGFIQTRYLRSHLKTHKDEQGSLSAEVDSIIQNIKDGPDSPALSENSP 2058 >SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 928 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 252 DITLENPTLALTMAMSPGPH--ASSYQCPICESTFVNTSDLEVHVNVDH 392 DI EN ++A H A ++C CE F ++S+L HV + H Sbjct: 847 DICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVKLVH 895 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 309 HASSYQCPICESTFVNTSDLEVHVNVDHKDIL 404 HA +C C+ F +LE HV H D L Sbjct: 261 HAIKTKCKYCKEGFATHKELETHVLSVHSDAL 292 >SB_21372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 387 DHKDILSPQKDDQIDNASCDDIVMMEESPVSNCPV 491 D DIL+ DD D DD + ++ +S+ PV Sbjct: 14 DDDDILNSDDDDDDDGGGGDDDIRIDNKEISSIPV 48 >SB_6334| Best HMM Match : zf-C2H2 (HMM E-Value=1.5e-26) Length = 611 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKDILSPQKDD 422 + CPIC F+ + L HV H +I +P+K D Sbjct: 330 FACPICSKRFMRSDHLSKHVKT-HNNI-TPKKAD 361 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 324 QCPICESTFVNTSDLEVH 377 +CPIC+ TF S L+VH Sbjct: 488 KCPICDQTFDTQSGLDVH 505 >SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHV 380 Y+CP CE F +S L HV Sbjct: 409 YKCPYCEKAFTASSILRTHV 428 >SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 618 Score = 27.9 bits (59), Expect = 7.7 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDH 392 ++C +C+ F+ +S L HV H Sbjct: 592 FKCTLCDKAFITSSHLRWHVKTQH 615 >SB_25397| Best HMM Match : zf-C2H2 (HMM E-Value=0.38) Length = 283 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 327 CPICESTFVNTSDLEVHVNVDHKDILSPQKDDQIDNASCD 446 C C++ F + L HV +H ++ S D Q CD Sbjct: 207 CKFCDTLFYWQAQLRFHVEDEHSELDSSPDDPQGKRNFCD 246 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 27.9 bits (59), Expect = 7.7 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKD 398 ++CP C+ +F ++L+ H+ V K+ Sbjct: 399 FRCPTCQKSFSQDANLKAHLRVHSKE 424 >SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 330 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 321 YQCPICESTFVNTSDLEVHVNVDHKD 398 Y+C +CE F S+L+ H++V H D Sbjct: 275 YKCALCEKAFNKLSNLKFHMHV-HTD 299 >SB_41428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 332 DLRKYIREHVRSGGPRECGSQGYIKSTERRS 424 D R Y+R R G R +GY++ ++RRS Sbjct: 17 DRRSYVRGSDRRGYVRGSDRRGYVRGSDRRS 47 >SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) Length = 237 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = -1 Query: 479 ANWTLFHHDYVIT*RIVYLIVFLWT*YILVI---HIHVDLQIGRVH 351 ++W HH +VI IV +I + T +++I H H L I +H Sbjct: 122 SSWIRRHHGFVIIIIIVIIITIIITIIVIIIIVHHHHHPLSIAIIH 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,477,761 Number of Sequences: 59808 Number of extensions: 440200 Number of successful extensions: 1483 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1482 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -