BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021732 (661 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 28 0.23 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 28 0.23 U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 25 2.8 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.7 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 3.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 4.9 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.5 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 28.3 bits (60), Expect = 0.23 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 273 VTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVD 398 + + LP+V ++ G+ +L N A FP P P+ V+ Sbjct: 247 IIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVE 288 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 28.3 bits (60), Expect = 0.23 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 273 VTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVD 398 + + LP+V ++ G+ +L N A FP P P+ V+ Sbjct: 247 IIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVE 288 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 24.6 bits (51), Expect = 2.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 553 NRGFDDRVDVAEIAGRVA*CIRARPPIVMRAD 458 N D V+ AGR+ CI +RP V RAD Sbjct: 82 NAKIDPAVEEQFNAGRLLACISSRPGQVGRAD 113 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 192 GTVSSTFDHPFSTPVLRSYWHETKSNS 272 G +S TFD PF + LR ++ + +S Sbjct: 1585 GELSRTFDRPFESVALRFVYNTSVDDS 1611 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 339 NLEAVVFPSAPSLKIPVTVDLCWTTADVTVEGVNVLATPS 458 NL F SA + P+ V VT+ GV+VLATP+ Sbjct: 123 NLWLGAFISACFVTYPLFVPGRGLPYGVTIPGVDVLATPT 162 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 4.9 Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 3/82 (3%) Frame = +2 Query: 422 HS*RSQCAGHPFIRSHYYWRSRPYASSYPPCDLGYINPIIKSPIPYTNHPRLNI---HFH 592 H A P SH +++P S +PP G + +I +P P T+H + H H Sbjct: 820 HHLHHHAAQQPPPGSHPGAQTQPQLSQHPPGASGRSSAVI-TP-PSTHHQAAAVAAHHHH 877 Query: 593 QSADAVLEGVRAGVKASVGHQR 658 A + A AS Q+ Sbjct: 878 LQHHAAMVAAAAAAAASQEQQQ 899 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +3 Query: 213 DHPFSTPVLRSYWHETKSNSVTVQSLPNV 299 + P+S + W T S S T + +PN+ Sbjct: 851 ERPYSVEAWQREWSTTTSGSWTRRLIPNI 879 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,187 Number of Sequences: 2352 Number of extensions: 12199 Number of successful extensions: 36 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -