BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021732 (661 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 7.9 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 7.9 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 7.9 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +2 Query: 524 YINPIIKSPIPYTNHPRLNIHFHQSADAVLEGVR 625 Y +P+ + + Y N + +Q D EGV+ Sbjct: 266 YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQ 299 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +2 Query: 524 YINPIIKSPIPYTNHPRLNIHFHQSADAVLEGVR 625 Y +P+ + + Y N + +Q D EGV+ Sbjct: 266 YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQ 299 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +2 Query: 524 YINPIIKSPIPYTNHPRLNIHFHQSADAVLEGVR 625 Y +P+ + + Y N + +Q D EGV+ Sbjct: 266 YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQ 299 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,736 Number of Sequences: 438 Number of extensions: 3426 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -