BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021727 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 4e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 7e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 49 3e-06 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 47 2e-05 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 34 0.12 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 30 1.5 SB_30187| Best HMM Match : ShlB (HMM E-Value=8.7) 29 2.6 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.4 SB_22758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 553 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 553 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 553 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 1e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +1 Query: 553 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 55.2 bits (127), Expect = 5e-08 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKV 378 W LN FGSS ASSAYQ WPT + H +SGF SR+S+ FKV Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 574 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 574 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 3e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 574 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 580 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 672 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 583 SAKECATTHLPKQPALKMDGAEAFCLYTTV 672 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 583 SAKECATTHLPKQPALKMDGAEAFCLYTTV 672 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 55 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 Score = 34.7 bits (76), Expect = 0.069 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 661 IGKTLQRHPFSGLVASA 611 IG TL+RHPFSGLVASA Sbjct: 24 IGATLERHPFSGLVASA 40 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 52 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 583 SAKECATTHLPKQPALKMDGAEAFCLYTTV 672 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 53 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 583 SAKECATTHLPKQPALKMDGAEAFCLYTTV 672 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 53 WHLNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 Score = 34.7 bits (76), Expect = 0.069 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 661 IGKTLQRHPFSGLVASA 611 IG TL+RHPFSGLVASA Sbjct: 22 IGATLERHPFSGLVASA 38 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 94 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.2 bits (112), Expect = 3e-06 Identities = 31/67 (46%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +1 Query: 481 DEPNVVLRRQKTLMGHHERRWSL---MTAGRWPWKSESAKECATTHLPKQPALKMDGAEA 651 DEPN LR Q + G W AKEC TTHLPKQ ALKMDGA+A Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNP--AKECVTTHLPKQLALKMDGAQA 60 Query: 652 FCLYTTV 672 LY V Sbjct: 61 SHLYRAV 67 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 137 WHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.8 bits (111), Expect = 4e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.0 bits (109), Expect = 7e-06 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN +GSS ASSAYQ WPT + H +SGF Sbjct: 15 WHLNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +2 Query: 512 KRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 607 +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 14 RRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSA Q WPT + H +SGF Sbjct: 72 WHLNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 W LN FGSS ASSAYQ PT + H +SGF Sbjct: 15 WHLNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -3 Query: 192 SRYGPPSGFPLTST*PGIVHHLSGPSICA 106 +RY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 29/67 (43%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Frame = +1 Query: 481 DEPNVVLRRQKTLMGHHERRWSL---MTAGRWPWKSESAKECATTHLPKQPALKMDGAEA 651 DEPN LR Q + G W KEC TT LPKQ ALKMDGA+A Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNP--LKECVTTPLPKQLALKMDGAQA 60 Query: 652 FCLYTTV 672 LY V Sbjct: 61 SHLYRAV 67 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPTWHRHQI 426 W LN FGSS ASSAYQ WPT + H + Sbjct: 15 WHLNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 193 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 104 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = +3 Query: 495 SVKAPKNAHGTP*KALVAHDSRTVAMEVGIR 587 +++ P +AH TP K LVA DSRTVAMEVGIR Sbjct: 3 TLEDPLDAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 574 KSESAKECATTHLPKQPALKM 636 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWPT 444 W LN FGSS ASSAYQ WPT Sbjct: 15 WHLNRAFGSSRIASSAYQKWPT 36 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 509 WRLNTTFGSSHSASSAYQNWP 447 W LN FGSS ASSAYQN P Sbjct: 15 WHLNRAFGSSRIASSAYQNGP 35 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 33.9 bits (74), Expect = 0.12 Identities = 22/48 (45%), Positives = 23/48 (47%) Frame = -1 Query: 560 PAVMSDQRLSWCPMSVFWRLNTTFGSSHSASSAYQNWPTWHRHQISGF 417 P V SD+R W P F GSS ASS YQN PT R GF Sbjct: 62 PFVGSDERRLWHPYRAF-------GSSRIASSGYQNGPTRTRIHCPGF 102 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.7 bits (71), Expect = 0.28 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 242 ISLSPLYPVPTIDLHVR 192 ISLSPLYP TIDLHVR Sbjct: 38 ISLSPLYPNLTIDLHVR 54 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.1 bits (67), Expect = 0.85 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 192 SRYGPPSGFPLTST*PGIVHH 130 +RY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +3 Query: 60 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDRSDSDVQID 209 L RR VSN + +++H+ + +DG+ V++K G++L++ D+DV ++ Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDVDLE 82 >SB_30187| Best HMM Match : ShlB (HMM E-Value=8.7) Length = 538 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = +1 Query: 190 TLTCKSIVGTGYRGERLIEPSRAGSVRSFPQDSWRRYKILKQSHPVKRMIRGIGAETTST 369 ++ +SIVG ++ P GS S DSW R++ K S + + G+G T Sbjct: 201 SIRLRSIVGYTFKQGLQGPPGEQGSPGSKRDDSWLRFQSSKTS--MTALTTGVGNGELMT 258 Query: 370 YSQT 381 Y+ T Sbjct: 259 YNPT 262 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 605 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 510 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_22758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 94 RRALSTNAGTRKMVNYAWSGRS-QGKP*WRTVATLTCKSIVGTGY 225 ++A STN T + W+ S Q KP +T T T +I+G GY Sbjct: 186 KQAQSTNISTP----FNWAKSSIQSKPVTKTTCTFTSNTIMGKGY 226 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,651,074 Number of Sequences: 59808 Number of extensions: 504261 Number of successful extensions: 1222 Number of sequences better than 10.0: 61 Number of HSP's better than 10.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1220 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -