BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021727 (674 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 2.9 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 8.8 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 8.8 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 8.8 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 8.8 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.6 bits (51), Expect = 2.9 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Frame = +2 Query: 32 LSSYVRD----FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEVRGNPD 175 + SY +D + T E +SV G +LGP W TM G +++ PD Sbjct: 600 IHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDIALPPD 652 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 536 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 625 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 536 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 625 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 536 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 625 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 536 GVGRS*QQDGGHGSRNPLRSVQRLTCRSNQ 625 G G + GG GS P + L C+ N+ Sbjct: 253 GTGGTGTSSGGGGSFQPPTLTEELLCKHNE 282 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,749 Number of Sequences: 2352 Number of extensions: 16273 Number of successful extensions: 82 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -