BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021725 (634 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 25 0.40 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.6 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 3.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 3.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 3.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 3.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 3.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 3.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 3.7 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 6.5 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 25.4 bits (53), Expect = 0.40 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 370 CERIRLCLEHPSQTAPVQSGCWSYW 444 C++ LC + P+ P+ C YW Sbjct: 150 CQKHPLCNDDPNGNVPLGKSCNRYW 174 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 146 HHWP--LTVILKVYSKDLSVELYG 81 H W ++LK+ SKDLS YG Sbjct: 93 HKWSTLFEILLKLESKDLSRTFYG 116 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 2.1 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 555 VGAHIYRPSRHADRDSTGTWRPSLTRADSWRTKSSPAPVAPT--PAL 421 + +H+ SR + + + P L +W+ S P+P AP+ PAL Sbjct: 38 MASHLMAASRLSLPTNPAFFHPGLLPL-AWQANSPPSPPAPSELPAL 83 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 502 DLEAVANTRRFVADKEFAGTSSSNTRSG 419 +L + A++ + E AGT+++N++SG Sbjct: 165 NLSSPASSTSSTSSTEKAGTNNNNSKSG 192 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 502 DLEAVANTRRFVADKEFAGTSSSNTRSG 419 +L + A++ + E AGT+++N++SG Sbjct: 165 NLSSPASSTSSTSSTEKAGTNNNNSKSG 192 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 502 DLEAVANTRRFVADKEFAGTSSSNTRSG 419 +L + A++ + E AGT+++N++SG Sbjct: 165 NLSSPASSTSSTSSTEKAGTNNNNSKSG 192 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 502 DLEAVANTRRFVADKEFAGTSSSNTRSG 419 +L + A++ + E AGT+++N++SG Sbjct: 165 NLSSPASSTSSTSSTEKAGTNNNNSKSG 192 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 502 DLEAVANTRRFVADKEFAGTSSSNTRSG 419 +L + A++ + E AGT+++N++SG Sbjct: 121 NLSSPASSTSSTSSTEKAGTNNNNSKSG 148 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 502 DLEAVANTRRFVADKEFAGTSSSNTRSG 419 +L + A++ + E AGT+++N++SG Sbjct: 165 NLSSPASSTSSTSSTEKAGTNNNNSKSG 192 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 502 DLEAVANTRRFVADKEFAGTSSSNTRSG 419 +L + A++ + E AGT+++N++SG Sbjct: 165 NLSSPASSTSSTSSTEKAGTNNNNSKSG 192 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 6.5 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 459 KSSPAPVAPTPALDRCSLRRMLQAETNPLAATSRRLTSIRSV 334 K SP AP+P+ SL + +NP ++ +TS SV Sbjct: 68 KKSPQG-APSPSSTPSSLPTQRTSTSNPTYSSRSVMTSCSSV 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,047 Number of Sequences: 336 Number of extensions: 2528 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -