BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021725 (634 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74045-1|CAA98552.1| 535|Caenorhabditis elegans Hypothetical pr... 56 2e-08 >Z74045-1|CAA98552.1| 535|Caenorhabditis elegans Hypothetical protein T27F2.1 protein. Length = 535 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/44 (50%), Positives = 30/44 (68%) Frame = -2 Query: 633 SKGIDSGYGEDDAYNVYDKPWRNQDNVGAHIYRPSRHADRDSTG 502 ++G+DSG +DD YN YD WR D+V H+YRPS++ D D G Sbjct: 420 TQGLDSGAMDDDTYNPYDAAWRGGDSVQQHVYRPSKNLDNDVYG 463 Score = 44.4 bits (100), Expect = 7e-05 Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -1 Query: 505 GDLEAVANTR-RFVADKEFAGTSSSNTRSGPVQFEKD 398 GDL+ + + RFVADK F+G S+ SGPVQFEKD Sbjct: 464 GDLDKIIEQKNRFVADKGFSGAEGSSRGSGPVQFEKD 500 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,673,092 Number of Sequences: 27780 Number of extensions: 228490 Number of successful extensions: 869 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1395683256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -