BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021723 (710 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 47 2e-07 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 25 0.80 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 2.5 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 5.7 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 5.7 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 5.7 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 7.5 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 46.8 bits (106), Expect = 2e-07 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 4/100 (4%) Frame = +2 Query: 224 AVRHQTLAPRRIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMTPY---VVTRYYR 394 A+ + LA R++HRDL N++V + T+K+ DFGL+R + + + Sbjct: 602 ALGMEHLAKTRVVHRDLAARNVLVCENHTVKVSDFGLSRDVYQDNVYCKNGGGKLPVRWM 661 Query: 395 APEVILGMGYTENVDIWSVGCIMGEMIR-GGVLFPGTDHS 511 A E + YT D+WS G ++ E++ GG + G S Sbjct: 662 ALESLTHQRYTTYSDVWSFGVLLWEIVTLGGTPYVGVHSS 701 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 24.6 bits (51), Expect = 0.80 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 39 FKLMKLVNHKNI-IGLLNAFTPQKSLEEFQD 128 F LM L NHKN+ +G L QK FQD Sbjct: 7 FALMLLANHKNVQVGDLVQKIAQKLQVLFQD 37 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 194 VIQIHLNHLAQISVHQLHNQVNV 126 V Q++L H +++HQ H+Q N+ Sbjct: 300 VEQMNLLHSNDLNMHQQHHQQNM 322 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 519 PLVEWSVPGNSTPPRIISPMMQPT 448 P +W+ P + PP + S + PT Sbjct: 48 PPSDWNCPQYNAPPYMSSVLQLPT 71 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -3 Query: 228 TASGTADSS--SVRDPDPSESLGTD*RPSAP*PG 133 T+SG+ DSS SV DP E+ + P PG Sbjct: 380 TSSGSTDSSSQSVEDPQQVEAAIVHLIANLPSPG 413 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 519 PLVEWSVPGNSTPPRIISPMMQPT 448 P +W+ P + PP + S + PT Sbjct: 39 PPSDWNCPQYNAPPYMSSVLQLPT 62 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 364 HHEGGPGGASQP 329 HH GGP QP Sbjct: 63 HHYGGPPSGGQP 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,679 Number of Sequences: 336 Number of extensions: 2978 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -