BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021722 (616 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.03 |||Lgl family protein|Schizosaccharomyces pombe|chr 1... 25 6.6 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 25 8.7 >SPAC1F3.03 |||Lgl family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1004 Score = 25.4 bits (53), Expect = 6.6 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = -1 Query: 238 SFRHLSCRKDKDFFSGLFIGSREVTFSAFVSFSHICALLQILNS*YT*HINKQH 77 S+R+L +KD + F+ F F F+ + +L I +S + H N H Sbjct: 344 SYRNLPAKKDVETFAEFFANPNSQRFFPFIDIPPVRDMLVIPSS--SPHYNGSH 395 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 25.0 bits (52), Expect = 8.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 181 GSREVTFSAFVSFSHICALLQIL 113 G REVTF+ F++FS + + IL Sbjct: 172 GLREVTFALFITFSIVPIITGIL 194 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,446,386 Number of Sequences: 5004 Number of extensions: 47086 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -