BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021722 (616 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6761| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_29585| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-07) 27 9.1 >SB_6761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 27.9 bits (59), Expect = 6.9 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = +2 Query: 152 KGAERNFSGSYKESTEKVFIL--SAAEVSK*HLPRAAV-VCVHSQIRATKPSSNHEKGYI 322 K A +N S + TE+ F L AA + L R V +C+ S + A +P H++GY Sbjct: 59 KMATQNEYASQNKRTERTFFLITKAALCLEYILGRFVVLICLSSVVSAIQPFRLHKEGYP 118 Query: 323 NDH 331 H Sbjct: 119 VSH 121 >SB_29585| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-07) Length = 408 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 122 TDIKQLIYITYK*TTHLNTFKPEETVNRQNKSTQIHSSR 6 TD + TY+ +TH+NT + V +STQ++S + Sbjct: 290 TDQRSTHVNTYQRSTHVNTDQRSTHVKTDQRSTQVNSDQ 328 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,470,955 Number of Sequences: 59808 Number of extensions: 335709 Number of successful extensions: 672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -