BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021721 (640 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.8 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 3.8 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 3.8 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 2.8 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -2 Query: 594 GSPQARRSLKCHPCPQSAFIIFFGIVGDSTPHLXD*TESNTTSTRSPPTETWTSTN 427 G+ Q R+ LKC C QS F + + T H+ T+ T +W S++ Sbjct: 471 GAEQTRQILKCMWCGQS-----FRSLAEMTSHMQQ-TQHYTNIISQEQIISWRSSD 520 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 594 GSPQARRSLKCHPCPQS 544 G+ QA+ LKC C QS Sbjct: 370 GAEQAKNVLKCVWCKQS 386 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 413 CSTHCNSIRVVADNDTGRPDR 351 CS +C +++ + D PDR Sbjct: 278 CSEYCRVFKMLQEEDIFTPDR 298 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 233 HAILPLHRGHVAETGEDSRRGACGRAGQK 319 HA+ P H HV T GA G++ Sbjct: 47 HAMHPYHANHVNPTANHVMGGAVPDVGKR 75 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,848 Number of Sequences: 336 Number of extensions: 1903 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -