BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021721 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0267 - 16333239-16333820,16333904-16334842,16334920-163351... 31 0.77 02_02_0183 + 7576901-7576908,7577666-7578176 29 4.1 09_06_0360 - 22510132-22510433,22510577-22510716,22510979-225110... 28 5.4 05_04_0299 - 19958776-19958858,19958883-19959012,19960131-199601... 28 5.4 12_01_0175 + 1304138-1304255,1304597-1304793,1304873-1304953,130... 27 9.5 11_01_0174 + 1394229-1394346,1394695-1394891,1394972-1395052,139... 27 9.5 >10_08_0267 - 16333239-16333820,16333904-16334842,16334920-16335172, 16336837-16337063,16338189-16339388 Length = 1066 Score = 31.1 bits (67), Expect = 0.77 Identities = 20/63 (31%), Positives = 31/63 (49%) Frame = +2 Query: 275 GEDSRRGACGRAGQKRQRRL*DKRPYGQDAQCRCQRLLGWSCSGCYRRRSELVEVQVSVG 454 G DSRR C G K + + + Q++Q + ++ +CS R+RS + V G Sbjct: 789 GPDSRRKLCNACGNKYRSGQLNSTTFSQNSQEQKKKSKSSACSR-ERKRSAVAATVVVGG 847 Query: 455 GLR 463 GLR Sbjct: 848 GLR 850 >02_02_0183 + 7576901-7576908,7577666-7578176 Length = 172 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +2 Query: 257 GHVAETGEDSRRGACGRAGQKRQRRL*DKRPYG 355 G VA RR CGRAG KR +R D P G Sbjct: 126 GSVARWRRWRRRRRCGRAGWKRGQRDGDAEPEG 158 >09_06_0360 - 22510132-22510433,22510577-22510716,22510979-22511049, 22511152-22511352,22511541-22511786,22512148-22512209, 22512314-22512620 Length = 442 Score = 28.3 bits (60), Expect = 5.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 261 WPRWRGNIAWMRVPPKPSLEL 199 W RWR ++AW+ +P+L+L Sbjct: 69 WRRWRPDVAWLPKALEPALQL 89 >05_04_0299 - 19958776-19958858,19958883-19959012,19960131-19960175, 19960252-19960370,19960450-19960543,19961824-19961985, 19962117-19962266,19962472-19962537,19962934-19962981, 19963654-19963866,19963953-19964078,19964155-19964232, 19964600-19964671,19965522-19965953,19966863-19966925, 19967497-19967898 Length = 760 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 185 TIPPLSSRLGLGGTRIHAILPLH 253 T+PP S RLG+ +++H + P H Sbjct: 638 TLPPSSYRLGVRPSKLHELFPSH 660 >12_01_0175 + 1304138-1304255,1304597-1304793,1304873-1304953, 1305080-1305289,1305426-1305503,1305576-1305878 Length = 328 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 86 YCIGAGSKRRKSSETRGCACRWKRVVG 6 YC+ +RK+S GC W R+ G Sbjct: 218 YCLKKKFSQRKASRACGCGTEWPRLEG 244 >11_01_0174 + 1394229-1394346,1394695-1394891,1394972-1395052, 1395184-1395393,1395531-1395608,1395682-1395990 Length = 330 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 86 YCIGAGSKRRKSSETRGCACRWKRVVG 6 YC+ +RK+S GC W R+ G Sbjct: 218 YCLKKKFSQRKASRACGCGTEWPRLEG 244 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,498,390 Number of Sequences: 37544 Number of extensions: 284168 Number of successful extensions: 1014 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -