BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021720 (739 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1767 + 29338867-29338912,29339261-29339325,29339571-293396... 29 2.9 06_01_0047 - 429838-429960,430413-430508,430589-430596,431088-43... 29 2.9 08_02_1277 + 25823835-25825113,25825201-25825418,25825501-258257... 28 8.9 >07_03_1767 + 29338867-29338912,29339261-29339325,29339571-29339642, 29339913-29339956,29340047-29340158,29340879-29340950, 29341449-29341511,29341957-29342034,29342110-29342202, 29342294-29342413,29342762-29342845,29343094-29343309, 29343401-29343448,29343761-29343871,29344170-29344267, 29345004-29345248,29345764-29345832,29345919-29345983, 29346168-29346337,29346434-29346512,29346614-29346869, 29347416-29347461,29347602-29347710,29347820-29347882, 29350075-29350107,29350924-29351442 Length = 991 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 121 EDKLPQCWYDDVRMNA-LFAPFRLKTTNPESWDMKMK 228 ED L C+Y D MNA +P +L + P +D K++ Sbjct: 39 EDLLVTCYYIDCGMNAYAISPAQLYSNTPSDFDFKLE 75 >06_01_0047 - 429838-429960,430413-430508,430589-430596,431088-431141, 431226-431274,431368-431466,431560-431639,431926-431989, 432082-432255,432342-432965,433046-433189,433262-433372, 433442-433498,433664-433798 Length = 605 Score = 29.5 bits (63), Expect = 2.9 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -3 Query: 428 PALGPVVKNSLIF*YWTKLSASKHFFDDNIKTGRSASFSLE 306 P + + N L+ KLS SK DDNIK RS S L+ Sbjct: 71 PHVNEISTNELLKTLKRKLSKSKRSEDDNIKMKRSESIELD 111 >08_02_1277 + 25823835-25825113,25825201-25825418,25825501-25825724, 25826468-25827080,25827735-25827775,25830549-25831191, 25832595-25834012,25834110-25834251,25834415-25834522, 25835346-25835558,25835643-25835753,25836099-25836293, 25836555-25836695,25836835-25836909 Length = 1806 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 361 FEAESFVQYQNINEFFTTGPRAGYVG 438 F+ S + Y IN++ T GPR VG Sbjct: 1315 FQHPSLLSYAGINQYNTMGPRVSVVG 1340 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,867,923 Number of Sequences: 37544 Number of extensions: 393646 Number of successful extensions: 933 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -