BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021718 (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.5 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 4.5 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 4.5 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 7.8 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 7.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +1 Query: 373 CSRRPRTTQSSASS*IQDGAVSHFPFGWLLS 465 C++ P + +S+ + +++ + P GWLLS Sbjct: 1954 CNKGPASDKSAFADFVKELHEAFKPKGWLLS 1984 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 68 LEESNSTSADDEWEHRRCNWTNRC 139 +EE N D +WE+ +C W C Sbjct: 2430 IEEWNFDGLDLDWEYPKC-WQVDC 2452 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +3 Query: 546 IALIGRIYGVVYERRIAIATLAAFSIDASLSTCDVATSTGHSF 674 I ++GRI G+ + ++ A + L CD TS SF Sbjct: 211 IGILGRIKGISGGEKKRLSFAAEVLTNPKLMFCDEPTSGLDSF 253 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +3 Query: 546 IALIGRIYGVVYERRIAIATLAAFSIDASLSTCDVATSTGHSF 674 I ++GRI G+ + ++ A + L CD TS SF Sbjct: 211 IGILGRIKGISGGEKKRLSFAAEVLTNPKLMFCDEPTSGLDSF 253 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 370 LAFIPIFTNPRFFKRSAELGLVA 302 L +P+ +P F + S E+GL + Sbjct: 363 LGHMPLLADPSFAQFSQEIGLAS 385 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 386 RELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAD 511 R L + H ++ T T + P RC + N EE+D Sbjct: 271 RHLIQRRTHTRHTTTSHNTRGTPRTTPASSRCGQLFNTEESD 312 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,064 Number of Sequences: 336 Number of extensions: 3180 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -