BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021711 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 27 0.55 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 0.97 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 25 1.7 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 25 2.2 EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 24 3.9 EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. 24 3.9 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 23 6.8 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 27.1 bits (57), Expect = 0.55 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +1 Query: 334 DDNMKTEDVPYQCYYKQLEDRRNECISLNEQINEAMSDLHKLTEQYNFVSNKTNAL--HN 507 +DN E + CYY+ + R + + ++EA DL LTE + V N +AL +N Sbjct: 72 NDNATAEYL--SCYYQNVRGLRTKTKEFHLAVSEADFDLIALTETW-LVDNIPSALLFNN 128 Query: 508 RVSSY 522 S Y Sbjct: 129 NFSVY 133 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 26.2 bits (55), Expect = 0.97 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = -2 Query: 237 PPSSLTPKIKDSRSKIASLWSELSGASGFSDDSHNNNLLCI 115 PP+ + + + A+ +E G+ G S +NNN + I Sbjct: 427 PPAGMNASMSSGKRSTATHQAEYGGSGGASSSINNNNNVTI 467 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 400 FFYLLIVYNSIGKGHLQSSYYHHRVAHTIPKSHMLY 293 F Y+ ++Y+ I YH+ + + IP ++L+ Sbjct: 271 FIYIYVIYDLIANECTPKLKYHYLMGYGIPAVYVLF 306 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 382 QLEDRRNECISLNEQINEAMSDLHKLTE 465 QLE NE + L+E N + + +LTE Sbjct: 101 QLEKTENEIVELSENNNALLQNFMELTE 128 >EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIAXIESTAFKRLRELKTLLLGSN 75 >EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIAXIESTAFKRLRELKTLLLGSN 75 >EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 122 SKLLLWESSENPLAPLNSDQREAILDLESLILGVN 226 S+L + S+N +A + S + + +L++L+LG N Sbjct: 41 SRLQTLDLSDNAIATIESTAFKRLRELKTLLLGSN 75 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 340 NMKTEDVPYQCYYKQLEDRRN 402 NM+ + + YY+QLE+R N Sbjct: 318 NMQAFKILREAYYQQLEERGN 338 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,669 Number of Sequences: 2352 Number of extensions: 13540 Number of successful extensions: 94 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -