BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021710 (626 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 2.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.2 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.3 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.6 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 23.0 bits (47), Expect = 2.4 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +2 Query: 194 HVSMSKNSRQPYCVSKEAGHQPVL 265 H+ ++ +P C+ + GH P+L Sbjct: 324 HIKSPYHTPEPDCIHELLGHMPLL 347 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 322 YHHHGHAEFGRQHVQY 275 +HHH H QH+ Y Sbjct: 351 HHHHHHQTQSLQHLHY 366 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.2 bits (45), Expect = 4.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 304 AEFGRQHVQYPMIQHWLVTSLLAHAVGLPRVL 209 ++FG +VQY + L T LA AV VL Sbjct: 284 SQFGENNVQYQGSEDILNTQSLAKAVSKNGVL 315 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 334 GQGAFGNMCRGGRMFAP 384 G G FG++CRG P Sbjct: 640 GGGEFGDVCRGKLKLPP 656 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,854 Number of Sequences: 438 Number of extensions: 2917 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -