BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021709 (743 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 3.4 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 3.4 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 6.0 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 22 6.0 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 182 ISKKYLSIYISRSLIDDLLCLLEFSIINLRNYLF 81 ++ K + I+++ IDDLL F + YLF Sbjct: 90 VAGKLIRIFLAAESIDDLLSNAVFCRDRVNPYLF 123 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 136 SIRERDIYILRYFLLIKNKIHSIVNFFISR 225 S+ + I +LR+ LL K+H + + F R Sbjct: 145 SLMVQAIQVLRFHLLELEKVHELCDNFCHR 174 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -1 Query: 182 ISKKYLSIYISRSLIDDLLCLLEFSIINLRNYLF 81 I+ + + I++ +DDLL + ++ + YLF Sbjct: 90 IAGRLIDIFLGMRNVDDLLSVAVYARDRVNPYLF 123 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 154 IYILRYFLLIKNKIHSI 204 +YI Y +LI+NKI ++ Sbjct: 178 LYICSYTVLIRNKISNL 194 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,296 Number of Sequences: 336 Number of extensions: 3416 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -