BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021709 (743 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharo... 27 3.7 SPAPB1A10.11c |||glutamyl-tRNA synthetase, mitochondrial|Schizos... 26 6.5 SPCC757.08 |||exosome subunit Rrp45 |Schizosaccharomyces pombe|c... 25 8.6 >SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 564 Score = 26.6 bits (56), Expect = 3.7 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +1 Query: 91 FRKLIIENSNKHNKSSIRERDIYILRYFLLIK 186 FR +I N++KH+ S +R I++ +Y+L ++ Sbjct: 33 FRVIIKSNAHKHDPSD--KRQIWLEKYYLFVR 62 >SPAPB1A10.11c |||glutamyl-tRNA synthetase, mitochondrial|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 121 KHNKSSIRERDIYILRYFLLIKNKIHSIVNF 213 K + SS Y + LL+KNK+H+I F Sbjct: 377 KFSHSSRSHDKSYTKKLLLLLKNKVHTIKEF 407 >SPCC757.08 |||exosome subunit Rrp45 |Schizosaccharomyces pombe|chr 3|||Manual Length = 291 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 447 CRYCEQNLHFIVHNFTIVDTTVMCLSVINTQC 352 C + ++HFI H+ +VD C++VI C Sbjct: 130 CWHVRASVHFINHDGNLVDAA--CIAVIAALC 159 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,699,333 Number of Sequences: 5004 Number of extensions: 52819 Number of successful extensions: 114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -