SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021709
         (743 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g41160.1 68415.m05084 ubiquitin-associated (UBA)/TS-N domain-...    29   2.5  

>At2g41160.1 68415.m05084 ubiquitin-associated (UBA)/TS-N
           domain-containing protein contains Pfam profile PF00627:
           UBA/TS-N domain
          Length = 287

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = +2

Query: 563 LITNRISSPLSTSILSKCQLLYYYRFLHRQCGGN-FEVF 676
           LI +  +   +T +LS   LLY++R   RQ G N + VF
Sbjct: 53  LIISAFAFSSTTQLLSGLYLLYFFRVFERQIGSNKYSVF 91


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,950,124
Number of Sequences: 28952
Number of extensions: 235104
Number of successful extensions: 395
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 386
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 395
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1643603136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -