BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021707 (594 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1255 + 28780181-28781172,28782065-28782932 38 0.006 02_01_0381 - 2764331-2764342,2768966-2769907 36 0.018 07_01_1120 - 10338265-10338624,10338739-10338873,10339411-10340451 31 0.92 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 25 1.1 01_06_1655 + 38940790-38940864,38941245-38942057,38942149-389422... 30 1.2 11_06_0143 + 20589574-20589684,20590256-20590873,20590943-205910... 30 1.6 10_08_0203 + 15776521-15776656,15776662-15776819 30 1.6 05_07_0220 + 28482589-28483752 29 2.1 06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088,813... 28 4.9 04_04_1560 - 34432491-34432837,34433097-34433292 28 4.9 04_01_0279 + 3743025-3745169 28 4.9 04_01_0213 - 2692253-2694562 28 4.9 09_01_0016 - 376742-376883,377973-378964 28 6.5 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 25 7.6 10_08_0299 - 16607152-16607322,16607465-16607785,16607870-166081... 27 8.5 06_03_0082 + 16363742-16364632 27 8.5 >06_03_1255 + 28780181-28781172,28782065-28782932 Length = 619 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = +3 Query: 417 EEEHILESVAQSKALMGVAELAKGIQYEEPI 509 +E ++E ++ KALM V E+AKGI Y EPI Sbjct: 104 QEREMIEHLSDRKALMPVGEIAKGISYSEPI 134 >02_01_0381 - 2764331-2764342,2768966-2769907 Length = 317 Score = 36.3 bits (80), Expect = 0.018 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = +3 Query: 417 EEEHILESVAQSKALMGVAELAKGIQYEEPIR 512 +E+ ++E ++ K LM V ELAKGI Y +P++ Sbjct: 113 QEKEMIEHLSDRKTLMSVRELAKGITYSDPLK 144 >07_01_1120 - 10338265-10338624,10338739-10338873,10339411-10340451 Length = 511 Score = 30.7 bits (66), Expect = 0.92 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 88 DVKDDPAPPPPIKRYRREEKSDSDEDVDNYEP 183 D D P PPPP+ R R E S E EP Sbjct: 2 DATDPPPPPPPLTRKRGREARKSKEAAPPREP 33 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 24.6 bits (51), Expect(2) = 1.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 103 PAPPPPIKRYRREEKSDSDEDVDNYE 180 P PPPP++R +S VD E Sbjct: 22 PPPPPPLRRLLTATRSGGSRWVDGSE 47 Score = 24.2 bits (50), Expect(2) = 1.1 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = +1 Query: 85 SDVKDDPAPPPP 120 S ++++PAPPPP Sbjct: 6 SGIQEEPAPPPP 17 >01_06_1655 + 38940790-38940864,38941245-38942057,38942149-38942268, 38942883-38943566 Length = 563 Score = 30.3 bits (65), Expect = 1.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 103 PAPPPPIKRYRREEKSDSDED 165 PAPPPP+ R+ + D D+D Sbjct: 121 PAPPPPVSARERQRRRDVDDD 141 >11_06_0143 + 20589574-20589684,20590256-20590873,20590943-20591010, 20591159-20591234,20591311-20591372,20591452-20591603, 20591889-20592052,20592129-20592317,20592417-20592538, 20592620-20592827,20593238-20593291,20593457-20593626, 20594265-20594355,20595405-20595529,20596372-20596444, 20596822-20596914,20597482-20597728,20598305-20598364, 20598461-20598590,20599008-20599014 Length = 939 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 79 KMSDVKDDPAPPPPIKRYRREEKSDSDED 165 K+SD +D P P K +EE+ D D+D Sbjct: 81 KVSDELEDDMKPLPAKEVHKEEEDDDDDD 109 >10_08_0203 + 15776521-15776656,15776662-15776819 Length = 97 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 100 DPAPPPPIKRYRREEKSDSDEDVDN 174 DPAPPPP++ RE++ + D D+ Sbjct: 14 DPAPPPPLRPALREDRLVASNDEDD 38 >05_07_0220 + 28482589-28483752 Length = 387 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -1 Query: 567 ISCLVSGRSRMQRGGRHDVLLALHIVYL*PTPPLPSGLCSALHSRVYVPLL 415 IS +G ++ +GG+H V +++ + P PP+P C V++PLL Sbjct: 204 ISIRSTGYQKLNQGGKHRVSKPVNVGSVRPNPPIPPLCC------VWLPLL 248 >06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088, 8135179-8135256,8135442-8135697,8136427-8136515, 8137229-8137376,8137460-8137899,8138048-8138562, 8138791-8139061,8139231-8139492,8139583-8139938 Length = 1004 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 109 PPPPIKRYRREEKSDSDEDVDNYE 180 PPP +R RR S D D+D E Sbjct: 914 PPPSRRRARRSPSSSDDSDIDGQE 937 >04_04_1560 - 34432491-34432837,34433097-34433292 Length = 180 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 480 PTPPLPSGLCSALHS--RVYVPLLLPVF 403 PTPP PSG SAL + +LLPVF Sbjct: 149 PTPPHPSGAASALGAGGLAVAAMLLPVF 176 >04_01_0279 + 3743025-3745169 Length = 714 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 536 CNVVDAMMSYWLFILYTFSQLRHSHQGFALR 444 C VV+ +S ILYT + + H+ GFA+R Sbjct: 240 CRVVEMELSLMYDILYTKAAVMHTWFGFAIR 270 >04_01_0213 - 2692253-2694562 Length = 769 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -2 Query: 533 NVVDAMMSYWLFILYTFSQLRHSHQGFALRYTLEYMFLFSCLF 405 +VVD +S ILYT + + H+ G+A+R++ F+ S +F Sbjct: 254 DVVDMELSLMYDILYTKAAMVHTWGGYAIRFSSH--FITSAMF 294 >09_01_0016 - 376742-376883,377973-378964 Length = 377 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 103 PAPPP-PIKRYRREEKSDSDEDVDNYEPYVP 192 P PPP + +++ S+SD D D+ EP +P Sbjct: 93 PLPPPLQANKNHQDQDSESDSDSDDDEPPLP 123 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 94 KDDPAPPPPIKRYRREEKSDSDEDVDNYEPYVP 192 K++P PPPP + EEK + V EP P Sbjct: 188 KEEPQPPPP----KEEEKPEPPPAVIIVEPPAP 216 Score = 21.0 bits (42), Expect(2) = 7.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 76 LKMSDVKDDPAPPPP 120 +K ++ D P PPPP Sbjct: 162 IKEIEIVDLPPPPPP 176 >10_08_0299 - 16607152-16607322,16607465-16607785,16607870-16608121, 16608298-16608435,16608544-16608651,16608814-16609014, 16609109-16609233,16609252-16609321,16609919-16610455 Length = 640 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 103 PAPPPPIKRYRREEKSDSDEDVDN 174 P PPP+K E++ D D+D D+ Sbjct: 128 PPRPPPVKDDDEEDEDDDDDDGDD 151 >06_03_0082 + 16363742-16364632 Length = 296 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 437 ECSAEQSPDGSGGVG 481 EC +E+ PDG GG+G Sbjct: 216 ECDSEELPDGGGGLG 230 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,144,420 Number of Sequences: 37544 Number of extensions: 311816 Number of successful extensions: 1351 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1324 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -