BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021707 (594 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 7.4 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 7.4 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 7.4 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 264 DTKSSSENDHDDETSQEEWGRRYNVSLLDQH 356 D+ SSS +D +S+EE + +S +Q+ Sbjct: 377 DSDSSSSSDSSSSSSEEE-AENFKISTAEQY 406 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 7.4 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 417 EEEHILESVAQSKALMGVAELAKGIQYEEPIRHHGVHHVASSIC 548 E +LE V Q K+ + VA + ++YE + G+ + +IC Sbjct: 822 ECRRLLERV-QRKSAIAVARTFRTVRYETAVLLAGLLPICRAIC 864 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,535 Number of Sequences: 2352 Number of extensions: 10117 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -