BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021702 (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.5 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 2.0 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 2.0 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 2.0 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 23 2.0 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.7 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 1.5 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 Query: 195 FRQRFPSYPCHNRLQSWLSLEPQAELGLSHVLRSAAGLTTKNISSFL 335 +R+RF + L W ++ QAE LS + A L T+N SS L Sbjct: 239 YRKRFRMEKIYVALV-W-GVKDQAEFTLSGQVMKYAALATENFSSLL 283 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 459 SYSGSPVHHSICPVLL 412 S+ G P+HH I P +L Sbjct: 91 SHHGPPIHHQIRPPIL 106 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 459 SYSGSPVHHSICPVLL 412 S+ G P+HH I P +L Sbjct: 91 SHHGPPIHHQIRPPIL 106 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 459 SYSGSPVHHSICPVLL 412 S+ G P+HH I P +L Sbjct: 91 SHHGPPIHHQIRPPIL 106 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 459 SYSGSPVHHSICPVLL 412 S+ G P+HH I P +L Sbjct: 91 SHHGPPIHHQIRPPIL 106 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 332 PYSTQTLSDWSIC*CFWRQRINLLYFGSNTG 424 P LS+++ C C W Q + LL G+ G Sbjct: 565 PTGGDALSEFNFCGCGWPQHM-LLPKGTEAG 594 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,084 Number of Sequences: 336 Number of extensions: 3655 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -